KEGG   Escherichia coli K-12 MG1655: b3455Help
Entry
b3455             CDS       T00007                                 

Gene name
livG
Definition
(RefSeq) branched-chain amino acid ABC transporter ATPase
  KO
K01995  branched-chain amino acid transport system ATP-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Module
eco_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3455 (livG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b3455 (livG)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    b3455 (livG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran BCA_ABC_TP_C AAA_21 AAA_23 AAA_15 SMC_N AAA_22 AAA_16 AAA_29 AAA_30 SRP54 FeoB_N RsgA_GTPase AAA_33 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 947967
NCBI-ProteinID: NP_417912
Pasteur: livG
RegulonDB: ECK120000530
ECOCYC: EG10537
ASAP: ABE-0011284
UniProt: P0A9S7
Position
complement(3593439..3594206)
Genome map
AA seq 255 aa AA seqDB search
MSQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGG
TILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKT
PSFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEP
AAGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQ
IRNNPDVIRAYLGEA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagccattattatctgttaacggcctgatgatgcgcttcggcggcctgctggcg
gtgaacaacgtcaatcttgaactgtacccgcaggagatcgtctcgttaatcggccctaac
ggtgccggaaaaaccacggtttttaactgtctgaccggattctacaaacccaccggcggc
accattttactgcgcgatcagcacctggaaggtttaccggggcagcaaattgcccgcatg
ggcgtggtgcgcaccttccagcatgtgcgtctgttccgtgaaatgacggtaattgaaaac
ctgctggtggcgcagcatcagcaactgaaaaccgggctgttctctggcctgttgaaaacg
ccatccttccgtcgcgcccagagcgaagcgctcgaccgcgccgcgacctggcttgagcgc
attggtttgctggaacacgccaaccgtcaggcgagtaacctggcctatggtgaccagcgc
cgtcttgagattgcccgctgcatggtgacgcagccggagattttaatgctcgacgaacct
gcggcaggtcttaacccgaaagagacgaaagagctggatgagctgattgccgaactgcgc
aatcatcacaacaccactatcttgttgattgaacacgatatgaagctggtgatgggaatt
tcggaccgaatttacgtggtcaatcaggggacgccgctggcaaacggtacgccggagcag
atccgtaataacccggacgtgatccgtgcctatttaggtgaggcataa

DBGET integrated database retrieval system