KEGG   Escherichia coli K-12 MG1655: b3456Help
Entry
b3456             CDS       T00007                                 

Gene name
livM
Definition
(RefSeq) branched-chain amino acid ABC transporter permease
  KO
K01998  branched-chain amino acid transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Module
eco_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3456 (livM)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b3456 (livM)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    b3456 (livM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2 DUF3382
Motif
Other DBs
NCBI-GeneID: 947966
NCBI-ProteinID: NP_417913
Pasteur: livM
RegulonDB: ECK120000534
ECOCYC: EG10541
ASAP: ABE-0011287
UniProt: P22729
Position
complement(3594203..3595480)
Genome map
AA seq 425 aa AA seqDB search
MKPMHIAMALLSAAMFFVLAGVFMGVQLELDGTKLVVDTASDVRWQWVFIGTAVVFFFQL
LRPAFQKGLKSVSGPKFILPAIDGSTVKQKLFLVALLVLAVAWPFMVSRGTVDIATLTMI
YIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTFALLNHYYGLGFWTCLPIAGLMAAAAGF
LLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGISQIPKPTLFGLEFSRTAR
EGGWDTFSNFFGLKYDPSDRVIFLYLVALLLVVLSLFVINRLLRMPLGRAWEALREDEIA
CRSLGLSPRRIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFAESAFVLAIVVLGGMG
SQFAVILAAILLVVSRELMRDFNEYSMLMLGGLMVLMMIWRPQGLLPMTRPQLKLKNGAA
KGEQA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgatgcatattgcaatggcgctgctctctgccgcgatgttctttgtgctggcg
ggcgtctttatgggcgtgcaactggagctggatggcaccaaactggtggtcgacacggct
tcggatgtccgttggcagtgggtgtttatcggcacggcggtggtctttttcttccagctt
ttgcgaccggctttccagaaagggttgaaaagcgtttccggaccgaagtttattctgccc
gccattgatggctccacggtgaagcagaaactgttcctcgtggcgctgttggtgcttgcg
gtggcgtggccgtttatggtttcacgcgggacggtggatattgccaccctgaccatgatc
tacattatcctcggtctcgggctgaacgtggttgttggtctttctggtctgctggtgctg
gggtacggcggtttttacgccatcggcgcttacacttttgcgctgctcaatcactattac
ggcttgggcttctggacctgcctgccgattgctggattaatggcagcggcggcgggcttc
ctgctcggttttccggtgctgcgtttgcgcggtgactatctggcgatcgttaccctcggt
ttcggcgaaattgtgcgcatattgctgctcaataacaccgaaattaccggcggcccgaac
ggaatcagtcagatcccgaaaccgacactcttcggactcgagttcagccgtaccgctcgt
gaaggcggctgggacacgttcagtaatttctttggcctgaaatacgatccctccgatcgt
gtcatcttcctctacctggtggcgttgctgctggtggtgctaagcctgtttgtcattaac
cgcctgctgcggatgccgctggggcgtgcgtgggaagcgttgcgtgaagatgaaatcgcc
tgccgttcgctgggcttaagcccgcgtcgtatcaagctgactgcctttaccataagtgcc
gcgtttgccggttttgccggaacgctgtttgcggcgcgtcagggctttgtcagcccggaa
tccttcacctttgccgaatcggcgtttgtgctggcgatagtggtgctcggcggtatgggc
tcgcaatttgcggtgattctggcggcaattttgctggtggtgtcgcgcgagttgatgcgt
gatttcaacgaatacagcatgttaatgctcggtggtttgatggtgctgatgatgatctgg
cgtccgcagggcttgctgcccatgacgcgcccgcaactgaagctgaaaaacggcgcagcg
aaaggagagcaggcatga

DBGET integrated database retrieval system