KEGG   Escherichia coli K-12 MG1655: b3457Help
Entry
b3457             CDS       T00007                                 

Gene name
livH
Definition
(RefSeq) leucine/isoleucine/valine transporter subunit
  KO
K01997  
branched-chain amino acid transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3457 (livH)
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    b3457 (livH)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    b3457 (livH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3595477..3596403)
Genome map
AA seq 308 aa AA seqDB search
MSEQFLYFLQQMFNGVTLGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAA
LMMMGIDTGWLLVAAGFVGAIVIASAYGWSIERVAYRPVRNSKRLIALISAIGMSIFLQN
YVSLTEGSRDVALPSLFNGQWVVGHSENFSASITTMQAVIWIVTFLAMLALTIFIRYSRM
GRACRACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGM
KAFTAAVLGGIGSIPGAMIGGLILGIAEALSSAYLSTEYKDVVSFALLILVLLVMPTGIL
GRPEVEKV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagtttttgtatttcttgcagcagatgtttaacggcgtcacgctgggcagt
acctacgcgctgatagccatcggctacaccatggtttacggcattatcggcatgatcaac
ttcgcccacggcgaggtttatatgattggcagctacgtctcatttatgatcatcgccgcg
ctgatgatgatgggcattgataccggctggctgctggtagctgcgggattcgtcggcgca
atcgtcattgccagcgcctacggctggagtatcgaacgggtggcttaccgcccggtgcgt
aactctaagcgcctgattgcactcatctctgcaatcggtatgtccatcttcctgcaaaac
tacgtcagcctgaccgaaggttcgcgcgacgtggcgctgccgagcctgtttaacggtcag
tgggtggtggggcatagcgaaaacttctctgcctctattaccaccatgcaggcggtgatc
tggattgttaccttcctcgccatgctggcgctgacgattttcattcgctattcccgcatg
ggtcgcgcgtgtcgtgcctgcgcggaagatctgaaaatggcgagtctgcttggcattaac
accgaccgggtgattgcgctgacctttgtgattggcgcggcgatggcggcggtggcgggt
gtgctgctcggtcagttctacggcgtcattaacccctacatcggctttatggccgggatg
aaagcctttaccgcggcggtgctcggtgggattggcagcattccgggagcgatgattggc
ggcctgattctggggattgcggaggcgctctcttctgcctatctgagtacggaatataaa
gatgtggtctcattcgccctgctgattctggtgctgctggtgatgccgaccggtattctg
ggtcgcccggaggtagagaaagtatga

DBGET integrated database retrieval system