KEGG   Escherichia coli K-12 MG1655: b3458Help
Entry
b3458             CDS       T00007                                 

Gene name
livK
Definition
(RefSeq) leucine transporter subunit
  KO
K01999  
branched-chain amino acid transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3458 (livK)
  Signal transduction
   02024 Quorum sensing system
    b3458 (livK)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    b3458 (livK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3596451..3597560)
Genome map
AA seq 369 aa AA seqDB search
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggaatgcgaaaactatcatcgcagggatgattgcactggcaatttcacacacc
gctatggctgacgatattaaagtcgccgttgtcggcgcgatgtccggcccgattgcccag
tggggcgatatggaatttaacggcgcgcgtcaggcaattaaagacattaatgccaaaggg
ggaattaagggcgataaactggttggcgtggaatatgacgacgcatgcgacccgaaacaa
gccgttgcggtcgccaacaaaatcgttaatgacggcattaaatacgttattggtcatctg
tgttcttcttctacccagcctgcgtcagatatctatgaagacgaaggtattctgatgatc
tcgccgggagcgaccaacccggagctgacccaacgcggttatcaacacattatgcgtact
gccgggctggactcttcccaggggccaacggcggcaaaatacattcttgagacggtgaag
ccccagcgcatcgccatcattcacgacaaacaacagtatggcgaagggctggcgcgttcg
gtgcaggacgggctgaaagcggctaacgccaacgtcgtcttcttcgacggtattaccgcc
ggggagaaagatttctccgcgctgatcgcccgcctgaaaaaagaaaacatcgacttcgtt
tactacggcggttactacccggaaatggggcagatgctgcgccaggcccgttccgttggc
ctgaaaacccagtttatggggccggaaggtgtgggtaatgcgtcgttgtcgaacattgcc
ggtgatgccgccgaaggcatgttggtcactatgccaaaacgctatgaccaggatccggca
aaccagggcatcgttgatgcgctgaaagcagacaagaaagatccgtccgggccttatgtc
tggatcacctacgcggcggtgcaatctctggcgactgcccttgagcgtaccggcagcgat
gagccgctggcgctggtgaaagatttaaaagctaacggtgcaaacaccgtgattgggccg
ctgaactgggatgaaaaaggcgatcttaagggatttgattttggtgtcttccagtggcac
gccgacggttcatccacggcagccaagtga

DBGET integrated database retrieval system