KEGG   Escherichia coli K-12 MG1655: b3460Help
Entry
b3460             CDS       T00007                                 

Gene name
livJ
Definition
(RefSeq) branched-chain amino acid ABC transporter periplasmic binding protein
  KO
K01999  branched-chain amino acid transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
eco02024  Quorum sensing
Module
eco_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3460 (livJ)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    b3460 (livJ)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    b3460 (livJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 ANF_receptor Peripla_BP_5 PGM_PMM_I Fe-ADH
Motif
Other DBs
NCBI-GeneID: 947971
NCBI-ProteinID: YP_026223
Pasteur: livJ
RegulonDB: ECK120000532
ECOCYC: EG10539
ASAP: ABE-0011299
UniProt: P0AD96
Structure
PDB: 

Jmol
Position
complement(3598555..3599658)
Genome map
AA seq 367 aa AA seqDB search
MNIKGKALLAGCIALAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKG
GIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
TPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARA
VQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAG
LKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFV
WTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHAN
GTATDAK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaagggtaaagcgttactggcaggatgtatcgcgctggcattcagcaatatg
gctctggcagaagatattaaagtcgcggtcgtgggcgcaatgtccggtccggttgcgcag
tacggtgaccaggagtttaccggcgcagagcaggcggttgcggatatcaacgctaaaggc
ggcattaaaggcaacaaactgcaaatcgtaaaatatgacgatgcctgtgacccgaaacag
gcggttgcggtggcgaacaaagtcgttaacgacggcattaaatatgtgattggtcacctc
tgttcttcatcaacgcagcctgcgtctgacatctacgaagacgaaggcattttaatgatc
accccagcggcaaccgcgccggagctgaccgcccgtggctatcagctgatcctgcgcacc
accggcctggactccgaccaggggccgacggcggcgaaatatattcttgagaaagtgaaa
ccgcagcgtattgctatcgttcacgacaaacagcaatacggcgaaggtctggcgcgagcg
gtgcaggacggcctgaagaaaggcaatgcaaacgtggtgttctttgatggcatcaccgcc
ggggaaaaagatttctcaacgctggtggcgcgtctgaaaaaagagaatatcgacttcgtt
tactacggcggttatcacccggaaatggggcaaatcctgcgtcaggcacgcgcggcaggg
ctgaaaactcagtttatggggccggaaggtgtggctaacgtttcgctgtctaacattgcg
ggcgaatcagcggaagggctgctggtgaccaagccgaagaactacgatcaggttccggcg
aacaaacccattgttgacgcgatcaaagcgaaaaaacaggacccaagtggcgcattcgtt
tggaccacctacgccgcgctgcaatctttgcaggcgggcctgaatcagtctgacgatccg
gctgaaatcgccaaatacctgaaagcgaactccgtggataccgtaatgggaccgctgacc
tgggatgagaaaggcgatctgaaaggctttgagttcggcgtatttgactggcacgccaac
ggcacggcgaccgatgcgaagtaa

DBGET integrated database retrieval system