KEGG   Escherichia coli K-12 MG1655: b3466Help
Entry
b3466             CDS       T00007                                 

Gene name
yhhL
Definition
(RefSeq) DUF1145 family protein
  KO
K08993  
putative membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3604979..3605248
Genome map
AA seq 89 aa AA seqDB search
MLINIGRLLMLCVWGFLILNLVHPFPRPLNIFVNVALIFTVLMHGMQLALLKSTLPKDGP
QMTTAEKVRIFLFGVFELLAWQKKFKVKK
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgctgattaatattggtcgtttgttaatgctctgcgtttggggatttttaatcctcaac
ctggtgcatcccttcccacgcccgctgaatatcttcgttaacgtggcgctgatttttacc
gtgctgatgcatggtatgcagctggcgctattgaaatccactttaccgaaagatggcccg
cagatgaccaccgccgaaaaggtacggattttccttttcggcgtgtttgaactgctggcc
tggcagaagaaatttaaagttaaaaaataa

DBGET integrated database retrieval system