KEGG   Escherichia coli K-12 MG1655: b3469Help
Entry
b3469             CDS       T00007                                 

Gene name
zntA
Definition
(RefSeq) zinc, cobalt and lead efflux system (EC:3.6.3.3 3.6.3.5)
  KO
K01534  
Cd2+/Zn2+-exporting ATPase [EC:3.6.3.3 3.6.3.5]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.3  Cd2+-exporting ATPase
     b3469 (zntA)
    3.6.3.5  Zn2+-exporting ATPase
     b3469 (zntA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3606451..3608649
Genome map
AA seq 732 aa AA seqDB search
MSTPDNHGKKAPQFAAFKPLTTVQNANDCCCDGACSSTPTLSENVSGTRYSWKVSGMDCA
ACARKVENAVRQLAGVNQVQVLFATEKLVVDADNDIRAQVESALQKAGYSLRDEQAAEEP
QASRLKENLPLITLIVMMAISWGLEQFNHPFGQLAFIATTLVGLYPIARQALRLIKSGSY
FAIETLMSVAAIGALFIGATAEAAMVLLLFLIGERLEGWAASRARQGVSALMALKPETAT
RLRKGEREEVAINSLRPGDVIEVAAGGRLPADGKLLSPFASFDESALTGESIPVERATGD
KVPAGATSVDRLVTLEVLSEPGASAIDRILKLIEEAEERRAPIERFIDRFSRIYTPAIMA
VALLVTLVPPLLFAASWQEWIYKGLTLLLIGCPCALVISTPAAITSGLAAAARRGALIKG
GAALEQLGRVTQVAFDKTGTLTVGKPRVTAIHPATGISESELLTLAAAVEQGATHPLAQA
IVREAQVAELAIPTAESQRALVGSGIEAQVNGERVLICAAGKHPADAFTGLINELESAGQ
TVVLVVRNDDVLGVIALQDTLRADAATAISELNALGVKGVILTGDNPRAAAAIAGELGLE
FKAGLLPEDKVKAVTELNQHAPLAMVGDGINDAPAMKAAAIGIAMGSGTDVALETADAAL
THNHLRGLVQMIELARATHANIRQNITIALGLKGIFLVTTLLGMTGLWLAVLADTGATVL
VTANALRLLRRR
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcctgacaatcacggcaagaaagcccctcaatttgctgcgttcaaaccgcta
accacggtacagaacgccaacgactgttgctgcgacggcgcatgttccagcacgccaact
ctctctgaaaacgtctccggcacccgctatagctggaaagtcagcggcatggactgcgcc
gcctgtgcgcgcaaggtagaaaatgccgtgcgccagcttgcaggcgtgaatcaggtgcag
gtgttgttcgccaccgaaaaactggtggtcgatgccgacaatgacattcgtgcacaagtt
gaatctgcgctgcaaaaagcaggctattccctgcgcgatgaacaggccgccgaagaaccg
caagcatcacgcctgaaagagaatctgccgctgattacgctaatcgtgatgatggcaatc
agctggggtctggagcagttcaatcatccgttcgggcaactggcgtttatcgcgaccacg
ctggttgggctgtacccgattgctcgtcaggcattacggttgatcaaatccggcagctac
ttcgccattgaaaccttaatgagcgtagccgctattggtgcactgtttattggcgcaacg
gctgaagctgcgatggtgttgctgctgtttttgattggtgaacgactggaaggctgggcc
gccagccgcgcgcgtcagggcgttagcgcgttaatggcgctgaaaccagaaaccgccacg
cgcctgcgtaagggtgagcgggaagaggtggcgattaacagcctgcgccctggcgatgtg
attgaagtcgccgcaggtgggcgtttgcctgccgacggtaaactgctctcaccgtttgcc
agttttgatgaaagcgccctgaccggcgaatccattccggtggagcgcgcaacgggcgat
aaagtccctgctggtgccaccagcgtagaccgtctggtgacgttggaagtgctgtcagaa
ccgggagccagcgccattgaccggattctgaaactgatcgaagaagccgaagagcgtcgc
gctcccattgagcggtttatcgaccgtttcagccgtatctatacgcccgcgattatggcc
gtcgctctgctggtgacgctggtgccaccgctgctgtttgccgccagctggcaggagtgg
atttataaagggctgacgctgctgctgattggctgcccgtgtgcgttagttatctcaacg
cctgcggcgattacctccgggctggcggcggcagcgcgtcgtggggcgttgattaaaggc
ggagcggcgctggaacagctgggtcgtgttactcaggtggcgtttgataaaaccggtacg
ctgaccgtcggtaaaccgcgcgttaccgcgattcatccggcaacgggtattagtgaatct
gaactgctgacactggcggcggcggtcgagcaaggcgcgacgcatccactggcgcaagcc
atcgtacgcgaagcacaggttgctgaactcgccattcccaccgccgaatcacagcgggcg
ctggtcgggtctggcattgaagcgcaggttaacggtgagcgcgtattgatttgcgctgcc
gggaaacatcccgctgatgcatttactggtttaattaacgaactggaaagcgccgggcaa
acggtagtgctggtagtacgtaacgatgacgtgcttggtgtcattgcgttacaggatacc
ctgcgcgccgatgctgcaactgccatcagtgaactgaacgcgctgggcgtcaaaggggtg
atcctcaccggcgataatccacgcgcagcggcggcaattgccggggagctggggctggag
tttaaagcgggcctgttgccggaagataaagtcaaagcggtgaccgagctgaatcaacat
gcgccgctggcgatggtcggtgacggtattaacgacgcgccagcgatgaaagctgccgcc
atcgggattgcaatgggtagcggcacagacgtggcgctggaaaccgccgacgcagcatta
acccataaccacctgcgcggcctggtgcaaatgattgaactggcacgcgccactcacgcc
aatatccgccagaacatcactattgcgctggggctgaaagggatcttcctcgtcaccacg
ctgttagggatgaccgggttgtggctggcagtgctggcagatacgggggcgacggtgctg
gtgacagcgaatgcgttaagattgttgcgcaggagataa

DBGET integrated database retrieval system