KEGG   Escherichia coli K-12 MG1655: b3474Help
Entry
b3474             CDS       T00007                                 

Gene name
yhhT
Definition
(RefSeq) UPF0118 family putative transporter
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AI-2E_transport
Motif
Other DBs
NCBI-GeneID: 947980
NCBI-ProteinID: NP_417931
Pasteur: yhhT
RegulonDB: ECK120002106
ECOCYC: EG12220
ASAP: ABE-0011347
UniProt: P0AGM0
Position
3611865..3612914
Genome map
AA seq 349 aa AA seqDB search
METPQPDKTGMHILLKLASLVVILAGIHAAADIIVQLLLALFFAIVLNPLVTWFIRRGVQ
RPVAITIVVVVMLIALTALVGVLAASFNEFISMLPKFNKELTRKLFKLQEMLPFLNLHMS
PERMLQRMDSEKVVTFTTALMTGLSGAMASVLLLVMTVVFMLFEVRHVPYKMRFALNNPQ
IHIAGLHRALKGVSHYLALKTLLSLWTGVIVWLGLELMGVQFALMWAVLAFLLNYVPNIG
AVISAVPPMIQVLLFNGVYECILVGALFLVVHMVIGNILEPRMMGHRLGMSTMVVFLSLL
IWGWLLGPVGMLLSVPLTSVCKIWMETTKGGSKLAILLGPGRPKSRLPG
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggaaacccctcaacccgataaaacgggcatgcacattctgctcaagctggcctcgctg
gtagtgatcctcgcgggcattcacgcagcggcagatatcattgtgcagctgttactggcg
ctgttttttgccatcgtcctcaacccgctcgtcacctggtttattcgtcggggagtacaa
cgccccgttgccattacgattgtagtggtggtgatgctgatcgcactaaccgcgctggtc
ggcgtactggcggcatcgtttaacgaatttatctctatgctgccgaagtttaataaggag
ctgacgcgcaaactttttaaattgcaggagatgttgccttttcttaatttgcatatgtcg
ccggagcgaatgctgcagcggatggactcggaaaaagtggttaccttcaccacagcgcta
atgaccgggctttccggggcaatggcgagcgtgcttttgctggtgatgaccgtagttttt
atgctgtttgaagtgcgccacgtcccttacaaaatgcgttttgcgctgaataatccacag
attcacatcgcgggattacaccgcgcacttaaaggcgtttcgcactatcttgcattgaag
acgctactcagtttatggacaggtgtcatcgtctggctggggctggagctgatgggggtg
cagtttgcgctgatgtgggcagtactggcgtttttgctcaactacgtgcccaatatcggc
gcggtaatttccgccgtaccgccaatgattcaggtgctgctgtttaatggtgtttacgaa
tgtattctggtcggcgcattgtttttagtggtccatatggtcatcggcaatattttagaa
ccacggatgatgggccatcgcctggggatgtccaccatggtggtatttctttcattgtta
atttggggatggctgctcggcccggtagggatgctactttcggtgccattaaccagcgtg
tgtaaaatctggatggaaaccaccaaaggcggtagcaaactggcgattttactggggccg
ggcagaccgaaaagtcggttaccgggatga

DBGET integrated database retrieval system