KEGG   Escherichia coli K-12 MG1655: b3476Help
Entry
b3476             CDS       T00007                                 

Gene name
nikA
Definition
(RefSeq) nickel-binding, heme-binding periplasmic protein
  KO
K15584  
nickel transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3476 (nikA)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    b3476 (nikA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3613667..3615241
Genome map
AA seq 524 aa AA seqDB search
MLSTLRRTLFALLACASFIVHAAAPDEITTAWPVNVGPLNPHLYTPNQMFAQSMVYEPLV
KYQADGSVIPWLAKSWTHSEDGKTWTFTLRDDVKFSNGEPFDAEAAAENFRAVLDNRQRH
AWLELANQIVDVKALSKTELQITLKSAYYPFLQELALPRPFRFIAPSQFKNHETMNGIKA
PIGTGPWILQESKLNQYDVFVRNENYWGEKPAIKKITFNVIPDPTTRAVAFETGDIDLLY
GNEGLLPLDTFARFSQNPAYHTQLSQPIETVMLALNTAKAPTNELAVREALNYAVNKKSL
IDNALYGTQQVADTLFAPSVPYANLGLKPSQYDPQKAKALLEKAGWTLPAGKDIREKNGQ
PLRIELSFIGTDALSKSMAEIIQADMRQIGADVSLIGEEESSIYARQRDGRFGMIFHRTW
GAPYDPHAFLSSMRVPSHADFQAQQGLADKPLIDKEIGEVLATHDETQRQALYRDILTRL
HDEAVYLPISYISMMVVSKPELGNIPYAPIATEIPFEQIKPVKP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctctccacactccgccgcactctatttgcgctgctggcttgtgcgtcttttatcgtc
catgccgctgcaccagatgaaatcaccaccgcctggccggtgaatgtcgggccactaaac
ccgcacctttacacgcctaaccagatgttcgcccagagcatggtttatgaaccattggtg
aaatatcaggcagacggttcggtgatcccgtggctggcaaaaagctggactcattcagaa
gatggtaaaacctggaccttcaccctgcgtgatgacgtgaaattctccaacggtgaaccg
ttcgatgccgaggcggcggcagaaaacttccgcgcagtgctcgataaccgtcaacgtcac
gcctggctggagctggcaaaccagattgttgatgttaaagcactcagtaaaacagagctg
caaattaccctgaaaagcgcctactatcctttcctgcaagaactggccctgccccgtcct
ttccgttttatcgctccctcgcagtttaaaaaccatgaaaccatgaacggaattaaagcg
ccgattggcaccggaccgtggattttgcaggaatcgaaactgaatcagtacgatgtcttc
gtccgtaacgaaaactactggggcgaaaagccagcgattaaaaagatcacctttaacgtc
atcccggacccgactacccgcgcggtggcgtttgaaactggcgatatcgacctgctgtac
ggaaacgaagggttattaccgctcgataccttcgcccgctttagccagaatccggcttac
cacacccaactgtcacagccgatcgaaaccgtgatgctggcgctcaataccgccaaagcc
cccaccaacgagctggcagtacgtgaagctcttaattacgcggtaaacaaaaaatcgctg
attgataacgcgttgtatggcacccagcaggtcgccgacaccctgtttgccccttctgtg
ccctacgccaacctcggcctgaaaccgagccagtacgatccgcaaaaagcgaaagcgttg
ctggaaaaagccggttggacgctgcctgcgggcaaagacatccgcgagaaaaatggtcag
ccgctgcgcattgaactttcgttcatcggcaccgatgcgttaagcaaatcgatggcggaa
atcattcaggctgatatgcgccagattggcgcagatgtctcgctgattggcgaagaagag
agcagtatctatgctcgtcagcgcgacggtcgttttggcatgattttccaccgcacctgg
ggcgcgccatatgatccacacgccttcctcagttcaatgcgcgtaccgtcacacgctgac
ttccaggcacagcaaggattagccgacaaaccgctgattgataaagagatcggcgaagtg
ctggcgacccatgacgaaacgcaacgtcaggcgctgtatcgcgacattctgacccgtctg
catgacgaggcggtttatctgcctatcagttacatctcaatgatggtggtatcaaaaccg
gagctgggtaacatcccctacgcgccgatcgccaccgaaattccgttcgaacagattaaa
ccggtgaaaccttaa

DBGET integrated database retrieval system