KEGG   Escherichia coli K-12 MG1655: b3477Help
Entry
b3477             CDS       T00007                                 

Gene name
nikB
Definition
(RefSeq) nickel transporter subunit
  KO
K15585  
nickel transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3477 (nikB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    b3477 (nikB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3615241..3616185
Genome map
AA seq 314 aa AA seqDB search
MLRYVLRRFLLLIPMVLAASVIIFLMLRLGTGDPALDYLRLSNLPPTPEMLASTRTMLGL
DQPLYVQYGTWLWKALHLDFGISFASQRPVLDDMLNFLPATLELAGAALVLILLTSVPLG
IWAARHRDRLPDFAVRFIAFLGVSMPNFWLAFLLVMAFSVYLQWLPAMGYGGWQHIILPA
VSIAFMSLAINARLLRASMLDVAGQRHVTWARLRGLNDKQTERRHILRNASLPMITAVGM
HIGELIGGTMIIENIFAWPGVGRYAVSAIFNRDYPVIQCFTLMMVVVFVVCNLIVDLLNA
ALDPRIRRHEGAHA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttacgtattacgccgctttctgctgctgatcccgatggtgctcgccgcctcg
gtgatcatttttctgatgctgcgcctcggtaccggcgacccggcgctcgattatttgcgt
ctgtctaacctgccgccgacgccggagatgctggcctctacccgcaccatgctgggactg
gatcagccgctgtacgtccagtacggcacctggttgtggaaggcgctgcatcttgacttt
ggtatctcattcgccagccaacgcccggtactggacgatatgctgaacttcctgcccgcc
acgctggaacttgcaggtgcggcgctggtattaattctgctcacttccgtaccgctcggt
atctgggcggcgcgccatcgcgaccgtctgccggatttcgccgtacgtttcatcgcgttt
cttggcgtgtcgatgcctaacttctggctggcgtttttactggtgatggcgttttcggtg
tatctgcaatggctacccgcgatgggttacggcggctggcagcacatcattttgcctgcg
gtttccattgcctttatgtcgctggcgattaacgcgcgtttactgcgcgccagtatgctg
gacgtcgccggtcagcgtcacgtcacctgggcgcgtctgcgcggcctgaacgacaaacag
accgaacgtcgccacatcctgcgcaatgcctcgctgccgatgatcaccgccgtggggatg
catatcggcgaactgattggcgggacgatgattatcgaaaacatctttgcctggccgggc
gtcgggcgctatgcggtgtcggcgatttttaaccgtgactatccggtgatccagtgcttt
acgctgatgatggtggtggtttttgtggtctgtaatttgattgtcgatttgctcaacgcc
gcgctggacccgcgcattcgtcgtcatgaaggagcgcacgcgtga

DBGET integrated database retrieval system