KEGG   Escherichia coli K-12 MG1655: b3478Help
Entry
b3478             CDS       T00007                                 

Gene name
nikC
Definition
(RefSeq) nickel transporter subunit
  KO
K15586  
nickel transport system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3478 (nikC)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    b3478 (nikC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3616182..3617015
Genome map
AA seq 277 aa AA seqDB search
MNFFLSSRWSVRLALIIIALLALIALTSQWWLPYDPQAIDLPSRLLSPDAQHWLGTDHLG
RDIFSRLMAATRVSLGSVMACLLLVLTLGLVIGGSAGLIGGRVDQATMRVADMFMTFPTS
ILSFFMVGVLGTGLTNVIIAIALSHWAWYARMVRSLVISLRQREFVLASRLSGAGHVRVF
VDHLAGAVIPSLLVLATLDIGHMMLHVAGMSFLGLGVTAPTAEWGVMINDARQYIWTQPL
QMFWPGLALFISVMAFNLVGDALRDHLDPHLVTEHAH
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgaactttttcctctcttcccgctggtcggtacgcctggcgctgatcattatcgccctg
ctggcgctgattgcgctcaccagccagtggtggctgccgtatgacccacaggcgattgat
ttgccgtcgcgcctgctttcgccggatgcgcagcactggctgggcaccgatcacttaggt
cgcgatattttctcgcggctgatggcagcgacccgcgtgtcgctcggttcggtaatggcc
tgcctgctgctggtgctgacattagggctggttattggcggcagcgccgggttgattggc
gggcgcgttgatcaggccaccatgcgcgtcgccgatatgtttatgaccttcccgacctcg
attctgtcgttctttatggttggcgtgctcggcaccgggctgaccaacgtaattatcgcc
atcgccctgtcgcactgggcgtggtatgcacgcatggtgcgcagcctggtgatttcacta
cgccaacgcgagtttgtgctggcgtcacggctttccggtgcgggccatgtgcgggtgttt
gtcgatcatctggcaggcgcggtgatcccttcgctgctggtgctggcaacgctggatatc
ggccatatgatgctgcacgtcgcggggatgtctttccttggcctcggtgtgaccgcgccg
accgccgaatggggcgtgatgattaacgacgcgcgccagtatatctggacccagccgctg
caaatgttctggccggggctggcgctgtttatcagcgtgatggcctttaacctggtgggt
gacgcactgcgcgatcatctggaccctcatctggtgacggagcacgcacactaa

DBGET integrated database retrieval system