KEGG   Escherichia coli K-12 MG1655: b3480Help
Entry
b3480             CDS       T00007                                 

Gene name
nikE
Definition
(RefSeq) nickel transporter subunit
  KO
K10824  
nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Module
Nickel transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3480 (nikE)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.24  nickel-transporting ATPase
     b3480 (nikE)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    b3480 (nikE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3617776..3618582
Genome map
AA seq 268 aa AA seqDB search
MTLLNISGLSHHYAHGGFNGKHQHQAVLNNVSLTLKSGETVALLGRSGCGKSTLARLLVG
LESPAQGNISWRGEPLAKLNRAQRKAFRRDIQMVFQDSISAVNPRKTVREILREPMRHLL
SLKKSEQLARASEMLKAVDLDDSVLDKRPPQLSGGQLQRVCLARALAVEPKLLILDEAVS
NLDLVLQAGVIRLLKKLQQQFGTACLFITHDLRLVERFCQRVMVMDNGQIVETQVVGEKL
TFSSDAGRVLQNAVLPAFPVRRRTTEKV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgactttacttaacatctccggcctttcccatcactatgcgcacggtggatttaacgga
aaacatcaacatcaggcggtgctgaataacgtttccctgaccctgaaaagcggcgaaacc
gtcgccctgctggggcgcagcggctgcgggaaaagtaccctcgcgcggttgctggtgggt
ttagaatcgcccgcgcaggggaatattagctggcgtggcgaaccgctggcgaaactcaat
cgcgcccagcgtaaagcgttccgccgcgatattcagatggtatttcaggactccatcagc
gccgtgaatccgcgcaaaaccgtgcgcgagatcctgcgtgaaccgatgcgccacctgcta
tcactgaaaaaatccgaacaactggcgcgcgccagcgaaatgctgaaggcggtcgatctc
gatgacagcgttctcgacaaacgcccaccgcagttaagcggcggccagctccagcgcgtc
tgcctggctcgcgcgctggcggtcgaaccgaaactactgattctggatgaagccgtttct
aaccttgatctcgtgttacaggcgggtgtcattcgcctgctgaaaaagctacaacaacag
tttggcaccgcctgcctgttcatcacccacgacttacgcctggtagaacgcttttgccag
cgggtaatggttatggacaacggacaaatcgtcgaaacccaggtggtgggagagaaatta
accttttcctctgacgccggacgtgtgctacaaaacgcggtattacccgcattccccgtg
cgccgtcgcaccacagaaaaggtttaa

DBGET integrated database retrieval system