KEGG   Escherichia coli K-12 MG1655: b3493Help
Entry
b3493             CDS       T00007                                 

Gene name
pitA
Definition
(RefSeq) phosphate transporter, low-affinity; tellurite importer
  KO
K16322  
low-affinity inorganic phosphate transporter
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3493 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3637642..3639141
Genome map
AA seq 499 aa AA seqDB search
MLHLFAGLDLHTGLLLLLALAFVLFYEAINGFHDTANAVATVIYTRAMRSQLAVVMAAVF
NFLGVLLGGLSVAYAIVHMLPTDLLLNMGSSHGLAMVFSMLLAAIIWNLGTWYFGLPASS
SHTLIGAIIGIGLTNALMTGTSVVDALNIPKVLSIFGSLIVSPIVGLVFAGGLIFLLRRY
WSGTKKRARIHLTPAEREKKDGKKKPPFWTRIALILSAIGVAFSHGANDGQKGIGLVMLV
LIGVAPAGFVVNMNATGYEITRTRDAINNVEAYFEQHPALLKQATGADQLVPAPEAGATQ
PAEFHCHPSNTINALNRLKGMLTTDVESYDKLSLDQRSQMRRIMLCVSDTIDKVVKMPGV
SADDQRLLKKLKSDMLSTIEYAPVWIIMAVALALGIGTMIGWRRVATTIGEKIGKKGMTY
AQGMSAQMTAAVSIGLASYTGMPVSTTHVLSSSVAGTMVVDGGGLQRKTVTSILMAWVFT
LPAAVLLSGGLYWLSLQFL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctacatttgtttgctggcctggatttgcataccgggctgttattattgcttgcactg
gcttttgtgctgttctacgaagccatcaatggtttccatgacacagccaacgccgtggca
accgttatctatacccgcgcgatgcgttctcagctcgccgtggttatggcggcggtattc
aactttttgggtgttttgctgggtggtctgagtgttgcctatgccattgtgcatatgctg
ccgacggatctgctgcttaatatgggatcgtctcatggccttgccatggtgttctctatg
ttgctggcggcgattatctggaacctgggtacctggtactttggtttacctgcatccagc
tctcatacgctgattggcgcgatcatcgggattggtttaaccaatgcgttgatgaccggg
acgtcagtggtggatgcactcaatatcccgaaagtattaagtattttcggttctctgatc
gtttcccctattgtcggcctggtgtttgctggcggtctgattttcttgctgcgtcgctac
tggagcggcaccaagaaacgcgcccgtatccacctgaccccagcggagcgtgaaaagaaa
gacggcaagaaaaagccgccgttctggacgcgtattgcgctgatcctttccgctatcggc
gtggcgttttcgcacggcgcgaacgatggtcagaaaggcattggtctggttatgttggta
ttgattggcgtcgcgccagcaggcttcgtggtgaacatgaatgccactggctacgaaatc
acccgtacccgtgatgccatcaacaacgtcgaagcttactttgagcagcatcctgcgctg
ctcaaacaggctaccggtgctgatcagttagtaccggctccggaagctggcgcaacgcaa
cctgcggagttccactgccatccgtcgaataccattaacgcgctcaaccgcctgaaaggt
atgttgaccaccgatgtggaaagctacgacaagctgtcgcttgatcaacgtagccagatg
cgccgcattatgctgtgcgtttctgacactatcgacaaagtggtgaagatgcctggcgtg
agtgctgacgatcagcgcctgttgaagaaactgaagtccgacatgcttagcaccatcgag
tatgcaccggtgtggatcatcatggcggtcgcgctggcgttaggtatcggtacgatgatt
ggctggcgccgtgtggcaacgactatcggtgagaaaatcggtaagaaaggcatgacctac
gctcaggggatgtctgcccagatgacggcggcagtgtctatcggcctggcgagttatacc
gggatgccggtttccactactcacgtactctcctcttctgtcgcggggacgatggtggta
gatggtggcggcttacagcgtaaaaccgtgaccagcattctgatggcctgggtgtttacc
cttccggctgcggtactgctttccggcgggctgtactggctctccttgcagttcctgtaa

DBGET integrated database retrieval system