KEGG   Escherichia coli K-12 MG1655: b3496Help
Entry
b3496             CDS       T00007                                 

Gene name
dtpB
Definition
(RefSeq) dipeptide and tripeptide permease B
  KO
K03305  
proton-dependent oligopeptide transporter, POT family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3640862..3642331
Genome map
AA seq 489 aa AA seqDB search
MNTTTPMGMLQQPRPFFMIFFVELWERFGYYGVQGVLAVFFVKQLGFSQEQAFVTFGAFA
ALVYGLISIGGYVGDHLLGTKRTIVLGALVLAIGYFMTGMSLLKPDLIFIALGTIAVGNG
LFKANPASLLSKCYPPKDPRLDGAFTLFYMSINIGSLIALSLAPVIADRFGYSVTYNLCG
AGLIIALLVYIACRGMVKDIGSEPDFRPMSFSKLLYVLLGSVVMIFVCAWLMHNVEVANL
VLIVLSIVVTIIFFRQAFKLDKTGRNKMFVAFVLMLEAVVFYILYAQMPTSLNFFAINNV
HHEILGFSINPVSFQALNPFWVVLASPILAGIYTHLGNKGKDLSMPMKFTLGMFMCSLGF
LTAAAAGMWFADAQGLTSPWFIVLVYLFQSLGELFISALGLAMIAALVPQHLMGFILGMW
FLTQAAAFLLGGYVATFTAVPDNITDPLETLPVYTNVFGKIGLVTLGVAVVMLLMVPWLK
RMIATPESH
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaacaacacccatggggatgctgcagcaacctcgcccatttttcatgatcttt
tttgtcgagttatgggagcgattcggctactacggcgtgcagggcgtactggcggttttc
ttcgttaaacagcttggattctcgcaagagcaggcttttgtcacttttggtgcttttgct
gcgctggtctatggcctcatttccattggcggctatgtcggcgaccacctgctggggacc
aaacgcaccattgttcttggagcacttgtgctggcgattggctacttcatgaccggcatg
tcgctacttaagcctgacctgattttcatcgccctggggactatcgctgtcggtaacggc
ctgtttaaagctaacccagccagcttgctttcgaagtgctatccgccgaaagatccgcgg
cttgatggcgcattcaccctgttctatatgtcgatcaacatcggctcgttgatagcgtta
tcgctggcccctgtgatcgctgatagattcggttattcagtcacctacaacctgtgcggg
gcggggttaattatcgcattactggtttacatcgcctgtcgtggaatggtgaaagacatt
ggttctgaacccgacttccggccaatgagcttcagcaaactgttgtacgtgttacttggc
agcgtggtgatgatcttcgtatgcgcatggctgatgcacaacgtagaagtcgccaatctg
gtgctgattgttctctccatcgtcgtcaccatcatcttctttcgtcaggcattcaagctg
gataaaaccgggcgcaataaaatgtttgtcgcctttgtcctgatgctcgaagcggtggtg
ttttacattctctacgcccagatgccaacatcgctgaacttctttgccatcaacaacgtg
catcatgaaattctcggtttttccatcaacccggtcagcttccaggcgcttaacccgttc
tgggtggtactcgccagcccaatactggcaggcatttacacgcatctgggtaacaaaggc
aaagacctctcgatgccgatgaaatttactctcggcatgtttatgtgctcactgggcttt
ttgacggcggcagctgcgggaatgtggtttgcggatgcacaagggctgacatcgccatgg
tttatcgtgctggtgtacttattccagagcttaggtgaactgtttattagcgcccttggc
ctggcgatgattgctgccctggtgccgcagcatttgatgggctttattctcgggatgtgg
ttcctgacgcaggctgccgcgttcttgctgggcggctatgtggcaacatttaccgcggtg
ccggacaacattaccgatccgcttgagacgttgcccgtctataccaacgtgtttggtaag
attggtctggtcacgctgggcgttgcagtagtgatgctgttgatggtgccgtggctgaaa
cgcatgattgcgacgccggaaagccattaa

DBGET integrated database retrieval system