KEGG   Escherichia coli K-12 MG1655: b3503Help
Entry
b3503             CDS       T00007                                 

Gene name
arsC
Definition
(RefSeq) arsenate reductase (EC:1.20.4.1)
  KO
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.20  Acting on phosphorus or arsenic in donors
   1.20.4  With disulfide as acceptor
    1.20.4.1  arsenate reductase (glutaredoxin)
     b3503 (arsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3650237..3650662
Genome map
AA seq 141 aa AA seqDB search
MSNITIYHNPACGTSRNTLEMIRNSGTEPTIIHYLETPPTRDELVKLIADMGISVRALLR
KNVEPYEELGLAEDKFTDDRLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLEILPDAQ
KGAFSKEDGEKVVDEAGKRLK
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacattaccatttatcacaacccggcctgcggcacgtcgcgtaatacgctggag
atgatccgcaacagcggcacagaaccgactattatccattatctggaaactccgccaacg
cgcgatgaactggtcaaactcattgccgatatggggatttccgtacgcgcgctgctgcgt
aaaaacgtcgaaccgtatgaggagctgggccttgcggaagataaatttactgacgatcgg
ttaatcgactttatgcttcagcacccgattctgattaatcgcccgattgtggtgacgccg
ctgggaactcgcctgtgccgcccttcagaagtggtgctggaaattctgccagatgcgcaa
aaaggcgcattctccaaggaagatggcgagaaagtggttgatgaagcgggtaagcgcctg
aaataa

DBGET integrated database retrieval system