KEGG   Escherichia coli K-12 MG1655: b3513Help
Entry
b3513             CDS       T00007                                 

Gene name
mdtE
Definition
(RefSeq) anaerobic multidrug efflux transporter, ArcA-regulated
  KO
K18898  
membrane fusion protein, multidrug efflux system
Organism
eco  Escherichia coli K-12 MG1655
Module
Multidrug resistance, efflux pump MdtEF-TolC
Brite
Transporters [BR:eco02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   b3513 (mdtE)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    b3513 (mdtE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3659232..3660389
Genome map
AA seq 385 aa AA seqDB search
MNRRRKLLIPLLFCGAMLTACDDKSAENAAAMTPEVGVVTLSPGSVNVLSELPGRTVPYE
VAEIRPQVGGIIIKRNFIEGDKVNQGDSLYQIDPAPLQAELNSAKGSLAKALSTASNARI
TFNRQASLLKTNYVSRQDYDTARTQLNEAEANVTVAKAAVEQATINLQYANVTSPITGVS
GKSSVTVGALVTANQADSLVTVQRLDPIYVDLTQSVQDFLRMKEEVASGQIKQVQGSTPV
QLNLENGKRYSQTGTLKFSDPTVDETTGSVTLRAIFPNPNGDLLPGMYVTALVDEGSRQN
VLLVPQEGVTHNAQGKATALILDKDDVVQLREIEASKAIGDQWVVTSGLQAGDRVIVSGL
QRIRPGIKARAISSSQENASTESKQ
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagaagaaagctgttaataccgttgttattctgcggcgcgatgctcaccgcc
tgcgatgacaaatcggcggaaaacgccgccgccatgacgcctgaggtcggtgtcgtcaca
ctctcccccggttcggtcaatgtgttgagcgaattgcccggtagaaccgttccttatgaa
gttgccgagatacgtccccaggtgggcggtattatcattaaacgcaactttatcgaaggc
gataaagtgaaccagggcgattcgctgtatcagattgatcctgcacctttacaggccgag
ctaaactccgccaaaggctcgctggcgaaagcgctctctaccgccagcaatgcccgcatc
acctttaaccgccaggcatcgttgctgaagaccaactacgttagccgtcaggattacgac
accgcgcgcacccagttgaatgaagcagaagccaatgtcaccgtcgccaaagcggctgtt
gaacaggcgacgatcaatctgcaatacgcgaatgtcacctcgccgattacgggcgtcagc
gggaaatcgtcggtgaccgtcggcgcactcgttaccgctaatcaggcagattcgctggtt
accgtacaacgtctggacccgatttatgtcgatctcacgcagtcggtgcaagatttctta
cgcatgaaagaagaggtcgccagtgggcaaatcaaacaggttcagggcagtacgccagta
cagctcaatctggaaaatggtaaacgctacagccagaccggcacgctgaaattctccgac
ccgacagtggatgaaaccacgggctccgtgacgttacgggcgattttccccaacccaaat
ggtgacttgctgcctggcatgtacgtcacggcattagtggatgaaggtagccgccagaat
gtattactggtgccgcaggaaggcgtcacccacaacgcccagggtaaagcaacggcgctc
attctggataaagacgatgtcgtgcagctacgcgaaattgaagccagcaaagccatcggc
gaccagtgggtcgtcacctctggcttgcaggctggcgatcgggtgatcgtttccggtttg
caacgcattcgtccgggtatcaaagcacgagcaatttcctccagccaggaaaacgccagc
accgaatcgaaacaataa

DBGET integrated database retrieval system