KEGG   Escherichia coli K-12 MG1655: b3514Help
Entry
b3514             CDS       T00007                                 

Gene name
mdtF
Definition
(RefSeq) anaerobic multidrug efflux transporter, ArcA-regulated
  KO
K18899  
multidrug efflux pump
Organism
eco  Escherichia coli K-12 MG1655
Module
Multidrug resistance, efflux pump MdtEF-TolC
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3514 (mdtF)
Antimicrobial resistance genes [BR:eco01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    b3514 (mdtF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3660414..3663527
Genome map
AA seq 1037 aa AA seqDB search
MANYFIDRPVFAWVLAIIMMLAGGLAIMNLPVAQYPQIAPPTITVSATYPGADAQTVEDS
VTQVIEQNMNGLDGLMYMSSTSDAAGNASITLTFETGTSPDIAQVQVQNKLQLAMPSLPE
AVQQQGISVDKSSSNILMVAAFISDNGSLNQYDIADYVASNIKDPLSRTAGVGSVQLFGS
EYAMRIWLDPQKLNKYNLVPSDVISQIKVQNNQISGGQLGGMPQAADQQLNASIIVQTRL
QTPEEFGKILLKVQQDGSQVLLRDVARVELGAEDYSTVARYNGKPAAGIAIKLAAGANAL
DTSRAVKEELNRLSAYFPASLKTVYPYDTTPFIEISIQEVFKTLVEAIILVFLVMYLFLQ
NFRATIIPTIAVPVVILGTFAILSAVGFTINTLTMFGMVLAIGLLVDDAIVVVENVERVI
AEDKLPPKEATHKSMGQIQRALVGIAVVLSAVFMPMAFMSGATGEIYRQFSITLISSMLL
SVFVAMSLTPALCATILKAAPEGGHKPNALFARFNTLFEKSTQHYTDSTRSLLRCTGRYM
VVYLLICAGMAVLFLRTPTSFLPEEDQGVFMTTAQLPSGATMVNTTKVLQQVTDYYLTKE
KDNVQSVFTVGGFGFSGQGQNNGLAFISLKPWSERVGEENSVTAIIQRAMIALSSINKAV
VFPFNLPAVAELGTASGFDMELLDNGNLGHEKLTQARNELLSLAAQSPNQVTGVRPNGLE
DTPMFKVNVNAAKAEAMGVALSDINQTISTAFGSSYVNDFLNQGRVKKVYVQAGTPFRML
PDNINQWYVRNASGTMAPLSAYSSTEWTYGSPRLERYNGIPSMEILGEAAAGKSTGDAMK
FMADLVAKLPAGVGYSWTGLSYQEALSSNQAPALYAISLVVVFLALAALYESWSIPFSVM
LVVPLGVVGALLATDLRGLSNDVYFQVGLLTTIGLSAKNAILIVEFAVEMMQKEGKTPIE
AIIEAARMRLRPILMTSLAFILGVLPLVISHGAGSGAQNAVGTGVMGGMFAATVLAIYFV
PVFFVVVEHLFARFKKA
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggctaactattttattgatcgcccggtttttgcctgggtacttgccattattatgatg
cttgcaggtggtctggcgatcatgaacttaccggttgcgcagtatccgcagattgcgcca
ccgaccattaccgtcagcgctacctatccaggtgccgatgcgcaaacggtagaagactcg
gtcactcaggtgattgagcaaaatatgaatgggcttgatggcctgatgtacatgtcttca
accagtgatgcggcgggcaatgcctctatcactctgaccttcgagactgggacatctcct
gatatcgcacaggttcaagtgcaaaataaactgcaactcgctatgccttcattacctgaa
gcagtgcagcagcaggggattagcgtcgataagtcgagcagtaatatcctgatggtagcg
gcgtttatttctgataacggcagcctcaaccagtacgatatcgcggactatgtagcgtct
aatatcaaagacccgctaagccgtaccgcgggcgttggtagcgtacaactctttggttcc
gagtatgccatgcgtatctggctggacccgcaaaaactcaataaatataacctggtacct
tccgatgttatttcccagattaaggtgcaaaacaaccagatttccggtggtcaactgggt
ggcatgccacaggcggcagaccagcagctaaacgcctcgatcattgtgcagacgcgtctg
caaacgccggaagaatttggcaaaatcctgttgaaagttcagcaagatggttcgcaagtg
ctgctgcgtgatgtcgctcgcgtcgaacttggggcggaagattattccaccgtggcacgc
tataacggcaaacctgctgccgggatcgccatcaaactggctgccggagcaaacgccctg
gatacctcgcgggcagtcaaagaggaactgaaccgcttatcagcctatttcccggcaagt
ctgaagacggtttatccttacgacaccacgccgtttatcgaaatttctattcaggaagtt
ttcaaaacactggttgaggctatcatcctagtcttcctggtcatgtatctgtttttgcag
aatttccgtgccacaatcatcccgacgattgccgtaccggtggttattctcgggacgttt
gcgatcttgtcggcggtcggtttcaccatcaacacgttgactatgttcgggatggtgctg
gcgatagggttactggtggatgacgccatcgtggtggtggagaacgtcgagcgtgtcatt
gcggaagataagctaccgccgaaggaagcgacgcataaatcgatggggcagatccaacgt
gcgctggtcggtattgccgttgttctttccgcagtgtttatgccgatggcctttatgagc
ggtgcaaccggggagatctaccgccagttctccatcacgctgatctcctccatgctgctt
tcagtatttgtggcaatgagcctgacccctgccctgtgcgccaccattctgaaagccgcg
ccggaaggcggtcacaaacctaacgccctgttcgcacgcttcaacacgctgtttgaaaaa
tcaactcaacactataccgatagcacccgctcgctgttgcgttgtaccggtcgctacatg
gtggtctacctgctgatttgcgccgggatggcggtgctgttcctgcgcacgccgacctct
ttcttaccagaagaggatcagggggtatttatgaccaccgcgcagttaccttccggtgcc
accatggttaacaccacgaaagtgctgcaacaggtgacggattattatctgactaaagag
aaagataatgtccagtcggtgtttaccgttggcggctttggcttcagcggtcaggggcaa
aacaacggcctggcgtttatcagtctcaagccgtggtctgaacgtgtcggtgaggaaaac
tcggttaccgcgatcattcagcgggcaatgattgcgttaagcagtatcaataaagccgtc
gtcttcccgttcaacttacccgcggtggctgaactgggtaccgcgtcaggttttgatatg
gaactgctggacaacggtaacctggggcacgaaaaactaacccaggcgcgaaacgagctg
ttatcactggcagcgcaatcaccgaatcaggtcaccggggtacgcccgaacggcctggaa
gatacgccgatgttcaaagtgaacgtcaacgctgcgaaagctgaagcgatgggcgtggcg
ctgtctgatatcaaccagacaatttccaccgccttcggcagcagctacgtgaacgacttc
ctcaaccaggggcgggtgaaaaaagtgtatgtccaggcaggcacgccgttccgtatgttg
ccggataacatcaaccaatggtatgtacgcaacgcctctggcacgatggcaccgctttct
gcctactcgtctaccgaatggacctatggttcaccgcgactggaacgctacaacggcatc
ccgtcaatggagattttaggtgaagcggcggccgggaaaagtaccggtgacgccatgaaa
tttatggcagacctggtcgctaaacttccggcaggcgtcggctactcatggaccggacta
tcgtatcaggaagcgttatcctcaaatcaggctcctgcgctgtatgcgatttcactggtc
gtggtgttcctcgccctcgccgcactctatgagagctggtcaattccgttctcggtgatg
ttggttgttccgttaggcgtcgttggcgcattactggccaccgatctgcgcggcttaagt
aatgacgtctacttccaggttggtttgctgaccaccatcgggctttccgccaaaaacgcc
atcctgattgtcgaatttgccgttgagatgatgcagaaagaagggaaaacgccgatagag
gcaatcatcgaagcggcgcggatgcgtttacgcccaatcctgatgacctctctggccttt
attctcggcgtgctgccgctggttatcagtcatggtgccggttctggcgcgcaaaacgcg
gtaggtaccggcgtgatgggcgggatgtttgccgcaacagtgctggcaatttacttcgtt
ccggtctttttcgttgtagtggaacatctctttgcccgctttaaaaaagcgtaa

DBGET integrated database retrieval system