KEGG   Escherichia coli K-12 MG1655: b3603Help
Entry
b3603             CDS       T00007                                 

Gene name
lldP
Definition
(RefSeq) L-lactate permease
  KO
K00427  
L-lactate permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3603 (lldP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3777399..3779054
Genome map
AA seq 551 aa AA seqDB search
MNLWQQNYDPAGNIWLSSLIASLPILFFFFALIKLKLKGYVAASWTVAIALAVALLFYKM
PVANALASVVYGFFYGLWPIAWIIIAAVFVYKISVKTGQFDIIRSSILSITPDQRLQMLI
VGFCFGAFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLIVNTAPVAFGAMGIPILVA
GQVTGIDSFEIGQMVGRQLPFMTIIVLFWIMAIMDGWRGIKETWPAVVVAGGSFAIAQYL
SSNFIGPELPDIISSLVSLLCLTLFLKRWQPVRVFRFGDLGASQVDMTLAHTGYTAGQVL
RAWTPFLFLTATVTLWSIPPFKALFASGGALYEWVINIPVPYLDKLVARMPPVVSEATAY
AAVFKFDWFSATGTAILFAALLSIVWLKMKPSDAISTFGSTLKELALPIYSIGMVLAFAF
ISNYSGLSSTLALALAHTGHAFTFFSPFLGWLGVFLTGSDTSSNALFAALQATAAQQIGV
SDLLLVAANTTGGVTGKMISPQSIAIACAAVGLVGKESDLFRFTVKHSLIFTCIVGVITT
LQAYVLTWMIP
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctggcaacaaaactacgatcccgccgggaatatctggctttccagtctgata
gcatcgcttcccatcctgtttttcttctttgcgctgattaagctcaaactgaaaggatac
gtcgccgcctcgtggacggtggcaatcgcccttgccgtggctttgctgttctataaaatg
ccggtcgctaacgcgctggcctcggtggtttatggtttcttctacgggttgtggcccatc
gcgtggatcattattgcagcggtgttcgtctataagatctcggtgaaaaccgggcagttt
gacatcattcgctcgtctattctttcgataacccctgaccagcgtctgcaaatgctgatc
gtcggtttctgtttcggcgcgttccttgaaggagccgcaggctttggcgcaccggtagca
attaccgccgcattgctggtcggcctgggttttaaaccgctgtacgccgccgggctgtgc
ctgattgttaacaccgcgccagtggcatttggtgcgatgggcattccaatcctggttgcc
ggacaggtaacaggtatcgacagctttgagattggtcagatggtggggcggcagctaccg
tttatgaccattatcgtgctgttctggatcatggcgattatggacggctggcgcggtatc
aaagagacgtggcctgcggtcgtggttgcgggcggctcgtttgccatcgctcagtacctt
agctctaacttcattgggccggagctgccggacattatctcttcgctggtatcactgctc
tgcctgacgctgttcctcaaacgctggcagccagtgcgtgtattccgttttggtgatttg
ggggcgtcacaggttgatatgacgctggcccacaccggttacactgcgggtcaggtgtta
cgtgcctggacaccgttcctgttcctgacagctaccgtaacactgtggagtatcccgccg
tttaaagccctgttcgcatcgggtggcgcgctgtatgagtgggtgatcaatattccggtg
ccgtacctcgataaactggttgcccgtatgccgccagtggtcagcgaggctacagcctat
gccgccgtgtttaagtttgactggttctctgccaccggcaccgccattctgtttgctgca
ctgctctcgattgtctggctgaagatgaaaccgtctgacgctatcagcaccttcggcagc
acgctgaaagaactggctctgcccatctactccatcggtatggtgctggcattcgccttt
atttcgaactattccggactgtcatcaacactggcgctggcactggcgcacaccggtcat
gcattcaccttcttctcgccgttcctcggctggctgggggtattcctgaccgggtcggat
acctcatctaacgccctgttcgccgcgctgcaagccaccgcagcacaacaaattggcgtc
tctgatctgttgctggttgccgccaataccaccggtggcgtcaccggtaagatgatctcc
ccgcaatctatcgctatcgcctgtgcggcggtaggcctggtgggcaaagagtctgatttg
ttccgctttactgtcaaacacagcctgatcttcacctgtatagtgggcgtgatcaccacg
cttcaggcttatgtcttaacgtggatgattccttaa

DBGET integrated database retrieval system