KEGG   Escherichia coli K-12 MG1655: b3653Help
Entry
b3653             CDS       T00007                                 

Gene name
gltS
Definition
(RefSeq) glutamate transporter
  KO
K03312  
glutamate:Na+ symporter, ESS family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3653 (gltS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3827460..3828665)
Genome map
AA seq 401 aa AA seqDB search
MFHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEV
NFDMSLRDPLMLAFFATIGLNANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLG
LDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFTNATEVAMACATFGLVLGGLIGGPVA
RYLVKHSTTPNGIPDDQEVPTAFEKPDVGRMITSLVLIETIALIAICLTVGKIVAQLLAG
TAFELPTFVCVLFVGVILSNGLSIMGFYRVFERAVSVLGNVSLSLFLAMALMGLKLWELA
SLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATPTAIANMQAI
TERFGPSHMAFLVVPMVGAFFIDIVNALVIKLYLMLPIFAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatctcgatactttagcaacgcttgttgccgcaacgctgacgttgctgctcggg
cgtaagttggtccattccgtctcctttttgaagaaatacaccataccggaacctgttgcg
ggtggtttgttggtggcgctggcgctactagtactgaaaaaaagcatgggctgggaagtc
aactttgatatgtccctgcgcgatccgttaatgctggctttcttcgccaccattggcctg
aacgccaacattgccagtttgcgtgccggtgggcgtgtggttggcatcttcttgattgtg
gttgttggtctgttggtgatgcaaaatgccattggcattggtatggctagcttgttaggg
cttgatccgctgatggggctgttggccggttctattactctttccggcggtcacggtacg
ggcgctgcgtggagtaaattgttcattgaacgttatggcttcaccaatgcgacggaagtg
gcgatggcctgtgcaacgttcggtctggtgctgggcggcttgattggcggtccggtggcg
cgctatctggtgaaacactccaccacgccgaacggtattccggatgaccaggaagtcccg
acggcgtttgaaaagccggatgtgggacgcatgatcacctcgttggtgctgattgaaact
atcgcgctgattgctatctgcctgacggtggggaaaattgttgcgcaacttttggctggc
actgcttttgaactgccgaccttcgtctgtgtactgtttgttggcgtgattctgagcaac
ggtctgtcaataatgggcttttaccgcgtctttgagcgtgcggtatccgtgctgggtaac
gtaagcttgtcgttgttcctggcgatggcgttgatggggctgaaactgtgggagctggct
tcgctggcgctgccgatgctggcgattctggtggtacagaccatcttcatggcgttgtat
gccatcttcgttacctggcgcatgatgggcaaaaactacgatgcggcagtgctggctgcg
ggtcactgtggttttggcctcggtgcaacgccaacggcaatcgccaacatgcaggcgatc
actgaacgctttggcccgtcgcacatggcgtttttggtggtgccgatggtcggtgcgttc
tttatcgatatcgtcaatgcgctggtaattaagttgtatttgatgttgccgatttttgcc
ggttaa

DBGET integrated database retrieval system