KEGG   Escherichia coli K-12 MG1655: b3667Help
Entry
b3667             CDS       T00007                                 

Gene name
uhpC
Definition
(RefSeq) membrane protein regulates uhpT expression
  KO
K07783  
MFS transporter, OPA family, sugar phosphate sensor protein UhpC
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b3667 (uhpC)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    b3667 (uhpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3847305..3848624)
Genome map
AA seq 439 aa AA seqDB search
MLPFLKAPADAPLMTDKYEIDARYRYWRRHILLTIWLGYALFYFTRKSFNAAVPEILANG
VLSRSDIGLLATLFYITYGVSKFVSGIVSDRSNARYFMGIGLIATGIINILFGFSTSLWA
FAVLWVLNAFFQGWGSPVCARLLTAWYSRTERGGWWALWNTAHNVGGALIPIVMAAAALH
YGWRAGMMIAGCMAIVVGIFLCWRLRDRPQALGLPAVGEWRHDALEIAQQQEGAGLTRKE
ILTKYVLLNPYIWLLSFCYVLVYVVRAAINDWGNLYMSETLGVDLVTANTAVTMFELGGF
IGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMPFASYVMQATCFFTIGFFVFG
PQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLAGWPLAKVLDTWHWSGFFVVISIAA
GISALLLLPFLNAQTPREA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgtttctgaaagcgcctgccgatgcgccattaatgactgataaatatgaaatt
gatgcccgctatcgctactggcgtcggcatattctgctgaccatctggctgggttacgcg
ctgttttacttcacgcggaaaagttttaacgccgccgtaccagaaatccttgctaacggc
gtgctcagccgtagcgatatcggcctgttagcgaccctgttttacattacctatggcgtg
tcgaagtttgtctccggcattgtcagcgatcgctcaaatgcccgttattttatggggata
gggcttatcgccacgggcattatcaacattctgtttggcttctcgacgtcgctatgggcg
tttgccgtgctctgggtgctgaacgcctttttccagggctggggttcaccggtgtgtgcg
cgtctgttaacggcctggtattcacgtaccgagcgcggcggttggtgggcattatggaac
acggcgcataacgtcggcggcgcactcattcccattgtgatggcagcggctgcgctgcat
tacggctggcgtgccgggatgatgattgctggttgtatggcgatagtcgtggggattttt
ctctgctggcggctacgcgatcgcccgcaggcgttaggtttaccggcggtcggtgaatgg
cgacacgacgcgctggaaattgctcaacaacaagaaggggcagggttgacgcgtaaagag
atcctcaccaaatatgtgttgctgaatccgtatatctggctgctttcgttttgctatgtg
ctggtctatgtggtccgggcggcgatcaacgactggggcaatttgtatatgtccgagaca
ctgggcgtcgatctggtcacggcgaatacggcagtgacgatgtttgaactgggcggattt
atcggtgcgctggtagccggttggggctcggacaaattgtttaacggcaaccgagggccg
atgaatttgattttcgccgccggaattttgctttcagtcggctccctgtggctgatgcca
tttgccagctacgtgatgcaggcaacctgcttcttcaccattggtttttttgtctttggc
ccacagatgttaatcggtatggcggcggcagagtgttcccacaaagaggcggcaggggcg
gcgacggggtttgtcggcttgtttgcttatctgggggcgtcgcttgctggttggccgctg
gcgaaagtactcgatacctggcactggagcggattttttgtggttatctctatcgccgcc
gggatttccgcactgctgttactgccctttttgaacgcccagacaccgcgcgaagcgtga

DBGET integrated database retrieval system