KEGG   Escherichia coli K-12 MG1655: b3705Help
Entry
b3705             CDS       T00007                                 

Gene name
yidC
Definition
(RefSeq) membrane protein insertase
  KO
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b3705 (yidC)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3705 (yidC)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    b3705 (yidC)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b3705 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3885076..3886722
Genome map
AA seq 548 aa AA seqDB search
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL
ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP
DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV
QNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD
NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT
GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII
ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL
GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK
MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL
HSREKKKS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcaacgcaatcttttagtcatcgctttgctgttcgtgtctttcatgatctgg
caagcctgggagcaggataaaaacccgcaacctcaggcccaacagaccacgcagacaacg
accaccgcagcgggtagcgccgccgaccagggcgtaccggccagtggccaggggaaactg
atctcggttaagaccgacgtgcttgatctgaccatcaacacccgtggtggtgatgttgag
caagctctgctgcctgcttacccgaaagagctgaactctacccagccgttccagctgttg
gaaacttcaccgcagtttatttatcaggcacagagcggtctgaccggtcgtgatggcccg
gataacccggctaacggcccgcgtccgctgtataacgttgaaaaagacgcttatgtgctg
gctgaaggtcaaaacgaactgcaggtgccgatgacgtataccgacgcggcaggcaacacg
tttaccaaaacgtttgtcctgaaacgtggtgattacgctgtcaacgtcaactacaacgtg
cagaacgctggcgagaaaccgctggaaatctcctcgtttggtcagttgaagcaatccatc
actctgccaccgcatctcgataccggaagcagcaacttcgcactgcacaccttccgtggc
gcggcgtactccacgcctgacgagaagtatgagaaatacaagttcgataccattgccgat
aacgaaaacctgaacatctcttcgaaaggtggttgggtggcgatgctgcaacagtatttc
gcgacggcgtggatcccgcataacgacggtaccaacaacttctataccgctaatctgggt
aacggcatcgccgctatcggctataaatctcagccggtactggttcagcctggtcagact
ggcgcgatgaacagcaccctgtgggttggcccggaaatccaggacaaaatggcagctgtt
gctccgcacctggatctgaccgttgattacggttggttgtggttcatctctcagccgctg
ttcaaactgctgaaatggatccatagctttgtgggtaactggggcttctccattatcatc
atcacctttatcgttcgtggcatcatgtacccgctgaccaaagcgcagtacacctccatg
gcgaagatgcgtatgttgcagccgaagattcaggcaatgcgtgagcgtctgggcgatgac
aaacagcgtatcagccaggaaatgatggcgctgtacaaagctgagaaggttaacccgctg
ggcggctgcttcccgctgctgatccagatgccaatcttcctggcgttgtactacatgctg
atgggttccgttgaactgcgtcaggcaccgtttgcactgtggatccacgacctgtcggca
caggacccgtactacatcctgccgatcctgatgggcgtaacgatgttcttcattcagaag
atgtcgccgaccacagtgaccgacccgatgcagcagaagatcatgacctttatgccggtc
atcttcaccgtgttcttcctgtggttcccgtcaggtctggtgctgtactatatcgtcagc
aacctggtaaccattattcagcagcagctgatttaccgtggtctggaaaaacgtggcctg
catagccgcgagaagaaaaaatcctga

DBGET integrated database retrieval system