KEGG   Escherichia coli K-12 MG1655: b3705Help
Entry
b3705             CDS       T00007                                 

Gene name
yidC
Definition
(RefSeq) membrane protein insertase
  KO
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    b3705 (yidC)
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    b3705 (yidC)
 Cellular Processes
  Cellular community
   02024 Quorum sensing
    b3705 (yidC)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    b3705 (yidC)
Secretion system [BR:eco02044]
 Sec (secretion) system
  Bacterial Sec-SRP core components [MD:M00335]
   b3705 (yidC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3885076..3886722
Genome map
AA seq 548 aa AA seqDB search
MDSQRNLLVIALLFVSFMIWQAWEQDKNPQPQAQQTTQTTTTAAGSAADQGVPASGQGKL
ISVKTDVLDLTINTRGGDVEQALLPAYPKELNSTQPFQLLETSPQFIYQAQSGLTGRDGP
DNPANGPRPLYNVEKDAYVLAEGQNELQVPMTYTDAAGNTFTKTFVLKRGDYAVNVNYNV
QNAGEKPLEISSFGQLKQSITLPPHLDTGSSNFALHTFRGAAYSTPDEKYEKYKFDTIAD
NENLNISSKGGWVAMLQQYFATAWIPHNDGTNNFYTANLGNGIAAIGYKSQPVLVQPGQT
GAMNSTLWVGPEIQDKMAAVAPHLDLTVDYGWLWFISQPLFKLLKWIHSFVGNWGFSIII
ITFIVRGIMYPLTKAQYTSMAKMRMLQPKIQAMRERLGDDKQRISQEMMALYKAEKVNPL
GGCFPLLIQMPIFLALYYMLMGSVELRQAPFALWIHDLSAQDPYYILPILMGVTMFFIQK
MSPTTVTDPMQQKIMTFMPVIFTVFFLWFPSGLVLYYIVSNLVTIIQQQLIYRGLEKRGL
HSREKKKS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggattcgcaacgcaatcttttagtcatcgctttgctgttcgtgtctttcatgatctgg
caagcctgggagcaggataaaaacccgcaacctcaggcccaacagaccacgcagacaacg
accaccgcagcgggtagcgccgccgaccagggcgtaccggccagtggccaggggaaactg
atctcggttaagaccgacgtgcttgatctgaccatcaacacccgtggtggtgatgttgag
caagctctgctgcctgcttacccgaaagagctgaactctacccagccgttccagctgttg
gaaacttcaccgcagtttatttatcaggcacagagcggtctgaccggtcgtgatggcccg
gataacccggctaacggcccgcgtccgctgtataacgttgaaaaagacgcttatgtgctg
gctgaaggtcaaaacgaactgcaggtgccgatgacgtataccgacgcggcaggcaacacg
tttaccaaaacgtttgtcctgaaacgtggtgattacgctgtcaacgtcaactacaacgtg
cagaacgctggcgagaaaccgctggaaatctcctcgtttggtcagttgaagcaatccatc
actctgccaccgcatctcgataccggaagcagcaacttcgcactgcacaccttccgtggc
gcggcgtactccacgcctgacgagaagtatgagaaatacaagttcgataccattgccgat
aacgaaaacctgaacatctcttcgaaaggtggttgggtggcgatgctgcaacagtatttc
gcgacggcgtggatcccgcataacgacggtaccaacaacttctataccgctaatctgggt
aacggcatcgccgctatcggctataaatctcagccggtactggttcagcctggtcagact
ggcgcgatgaacagcaccctgtgggttggcccggaaatccaggacaaaatggcagctgtt
gctccgcacctggatctgaccgttgattacggttggttgtggttcatctctcagccgctg
ttcaaactgctgaaatggatccatagctttgtgggtaactggggcttctccattatcatc
atcacctttatcgttcgtggcatcatgtacccgctgaccaaagcgcagtacacctccatg
gcgaagatgcgtatgttgcagccgaagattcaggcaatgcgtgagcgtctgggcgatgac
aaacagcgtatcagccaggaaatgatggcgctgtacaaagctgagaaggttaacccgctg
ggcggctgcttcccgctgctgatccagatgccaatcttcctggcgttgtactacatgctg
atgggttccgttgaactgcgtcaggcaccgtttgcactgtggatccacgacctgtcggca
caggacccgtactacatcctgccgatcctgatgggcgtaacgatgttcttcattcagaag
atgtcgccgaccacagtgaccgacccgatgcagcagaagatcatgacctttatgccggtc
atcttcaccgtgttcttcctgtggttcccgtcaggtctggtgctgtactatatcgtcagc
aacctggtaaccattattcagcagcagctgatttaccgtggtctggaaaaacgtggcctg
catagccgcgagaagaaaaaatcctga

DBGET integrated database retrieval system