KEGG   Escherichia coli K-12 MG1655: b3721Help
Entry
b3721             CDS       T00007                                 

Gene name
bglB
Definition
(RefSeq) cryptic phospho-beta-glucosidase B
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00010  Glycolysis / Gluconeogenesis
eco00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    b3721 (bglB)
   00500 Starch and sucrose metabolism
    b3721 (bglB)
Enzymes [BR:eco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     b3721 (bglB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Albumin_I_a
Motif
Other DBs
NCBI-GeneID: 948234
NCBI-ProteinID: NP_418177
Pasteur: bglB
RegulonDB: ECK120000110
ECOCYC: EG10114
ASAP: ABE-0012169
UniProt: P11988
Position
complement(3902289..3903701)
Genome map
AA seq 470 aa AA seqDB search
MKAFPETFLWGGATAANQVEGAWQEDGKGISTSDLQPHGVMGKMEPRILGKENIKDVAID
FYHRYPEDIALFAEMGFTCLRISIAWARIFPQGDEVEPNEAGLAFYDRLFDEMAQAGIKP
LVTLSHYEMPYGLVKNYGGWANRAVIDHFEHYARTVFTRYQHKVALWLTFNEINMSLHAP
FTGVGLAEESGEAEVYQAIHHQLVASARAVKACHSLLPEAKIGNMLLGGLVYPLTCQPQD
MLQAMEENRRWMFFGDVQARGQYPGYMQRFFRDHNITIEMTESDAEDLKHTVDFISFSYY
MTGCVSHDESINKNAQGNILNMIPNPHLKSSEWGWQIDPVGLRVLLNTLWDRYQKPLFIV
ENGLGAKDSVEADGSIQDDYRIAYLNDHLVQVNEAIADGVDIMGYTSWGPIDLVSASHSQ
MSKRYGFIYVDRDDNGEGSLTRTRKKSFGWYAEVIKTRGLSLKKITIKAP
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatttccagaaacatttctttggggtggcgcaacagctgccaatcaggtggaa
ggtgcctggcaggaagatggcaaagggatctcgacctcagatttacagcctcatggcgta
atgggaaaaatggaaccgcgcatcctggggaaagagaatatcaaagatgtcgccatcgat
ttttatcaccgttacccggaagatatcgcgttatttgccgagatgggcttcacctgtctg
cgtatttccattgcctgggcgcgaattttccctcagggcgacgaagtcgaaccgaatgaa
gcggggttagcgttttacgatcggctgtttgatgaaatggcgcaggcggggatcaagccg
ctggtaacgttatcccattacgaaatgccatatgggctggtgaaaaactacggcggttgg
gctaatcgagcggtcatcgatcacttcgagcattacgcccgcacggtctttactcgctac
caacataaagtggcgttatggctgacgtttaatgaaatcaacatgtcgttacacgcgcca
ttcacgggcgtggggctggcagaagagagtggcgaggcggaagtttatcaggctatccac
catcaactggttgccagtgcgcgggcagttaaagcctgtcatagcctgctccccgaagcg
aaaatcggcaatatgcttctcggtgggctggtttaccccctcacctgccagccacaggat
atgttgcaggccatggaagagaaccggcgctggatgttctttggtgatgttcaggcgcgt
ggccagtatcccggctatatgcagcgtttcttccgcgaccacaatatcaccattgagatg
actgaaagtgacgcagaagatttaaaacataccgtcgatttcatctcttttagttattac
atgactggttgtgtttcccacgacgaaagcattaataaaaatgcgcagggcaacatactg
aatatgatccccaatccgcatctgaaaagttcagagtgggggtggcaaattgatccggtt
ggattacgggttctgttaaatacgctttgggatcgttatcaaaaaccgttatttattgtc
gagaacggattaggcgcaaaagacagcgttgaagcggatggttcgatacaggacgattat
cgaattgcctatttaaacgatcacctggtacaggtaaatgaagcgattgccgatggtgtg
gatattatggggtacaccagttgggggccaattgatttagtcagtgcatctcattcacaa
atgtctaagcgctacggctttatttatgtggatcgtgatgataatggcgaaggaagcctc
acaagaacacgcaagaaaagcttcggatggtatgcagaggtgatcaagacgcgggggctg
tcattaaaaaaaataaccattaaagcaccttaa

DBGET integrated database retrieval system