KEGG   Escherichia coli K-12 MG1655: b3728Help
Entry
b3728             CDS       T00007                                 

Gene name
pstS
Definition
(RefSeq) periplasmic phosphate binding protein, high-affinity
  KO
K02040  
phosphate transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3728 (pstS)
  Signal transduction
   02020 Two-component system
    b3728 (pstS)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    b3728 (pstS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3910485..3911525)
Genome map
AA seq 346 aa AA seqDB search
MKVMRTTVATVVAATLSMSAFSVFAEASLTGAGATFPAPVYAKWADTYQKETGNKVNYQG
IGSSGGVKQIIANTVDFGASDAPLSDEKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVL
DGKTLGDIYLGKIKKWDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEE
WKNNVGTGSTVKWPIGLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGK
PVSPTEENFANAAKGADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLK
FFDWAYKTGAKQANDLDYASLPDSVVEQVRAAWKTNIKDSSGKPLY
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatgcgtaccaccgtcgcaactgttgtcgccgcgaccttatcgatgagtgct
ttctctgtgtttgcagaagcaagcctgacaggtgcaggtgcaaccttccctgcgccggtg
tatgccaaatgggctgacacttaccagaaagaaaccggtaataaagttaactaccagggt
atcggttcttccggtggcgtaaaacagattatcgctaataccgttgattttggtgcctct
gacgcgccgctgtctgacgaaaaactggctcaggaaggtctgttccagttcccgaccgtg
attggcggcgtggtgctggcggttaacattccagggctgaagtctggcgaactggtgctg
gatggtaaaaccctcggcgacatctacctgggcaaaatcaagaagtgggatgatgaagcc
atcgccaaactgaatccgggtctgaaactgccttcacaaaacattgctgtagtacgccgc
gcagatggctccgggacttccttcgtcttcaccagctacctggcgaaagtgaacgaagag
tggaaaaacaacgttggtactggctctaccgtaaaatggccgatcggtctgggcggtaaa
ggtaacgacggtatcgccgcgttcgttcagcgtctgccgggtgcaattggttatgttgaa
tatgcttacgcgaagcagaacaacctggcgtacaccaaactgatctccgctgatggtaaa
ccggttagtccgaccgaagaaaacttcgctaatgcagcaaaaggtgcagactggagcaaa
accttcgctcaggatctgaccaaccagaaaggcgaagatgcatggcctattacctctacc
acgttcattctgatccacaaagatcagaagaaaccagaacaaggcacagaagtgctgaaa
ttcttcgactgggcgtacaaaaccggggctaaacaggcgaacgacctggattacgccagc
ctgccggatagtgtagttgaacaggttcgcgctgcgtggaagaccaatattaaagacagt
agcggtaagccgctgtactaa

DBGET integrated database retrieval system