KEGG   Escherichia coli K-12 MG1655: b3730Help
Entry
b3730             CDS       T00007                                 

Gene name
glmU
Definition
(RefSeq) fused N-acetyl glucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyl transferase
  KO
K04042  
bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    b3730 (glmU)
Enzymes [BR:eco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.157  glucosamine-1-phosphate N-acetyltransferase
     b3730 (glmU)
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     b3730 (glmU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3913830..3915200)
Genome map
AA seq 456 aa AA seqDB search
MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGD
LLKQALKDDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPLISVETLQRLRDA
KPQGGIGLLTVKLDDPTGYGRITRENGKVTGIVEHKDATDEQRQIQEINTGILIANGADM
KRWLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQ
SEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKN
SVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSK
AGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGAT
IAAGTTVTRNVGENALAISRVPQTQKEGWRRPVKKK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttgaataatgctatgagcgtagtgatccttgccgcaggcaaaggcacgcgcatgtat
tccgatcttccgaaagtgctgcatacccttgccgggaaagcgatggttcagcatgtcatt
gatgctgcgaatgaattaggcgcagcgcacgttcacctggtgtacggtcacggcggcgat
ctgctaaaacaggcgctgaaagacgacaaccttaactgggtgcttcaggcagagcagctg
ggtacgggtcatgcaatgcagcaggccgcacctttctttgccgatgatgaagacatttta
atgctctacggcgacgtgccgctgatctctgtcgaaacactccagcgtctgcgtgatgct
aaaccgcagggtggcattggtctgctgacggtgaaactggatgatccgaccggttatgga
cgtatcacccgtgaaaacggcaaagttaccggcattgttgagcacaaagatgccaccgac
gagcagcgtcagattcaggagatcaacaccggcattctgattgccaacggcgcagatatg
aaacgctggctggcgaagctgaccaacaataatgctcagggcgaatactacatcaccgac
attattgcgctggcgtatcaggaagggcgtgaaatcgtcgccgttcatccgcaacgttta
agcgaagtagaaggcgtgaataaccgcctgcaactctcccgtctggagcgtgtttatcag
tccgaacaggctgaaaaactgctgttagcaggcgttatgctgcgcgatccagcgcgtttt
gatctgcgtggtacgctaactcacgggcgcgatgttgaaattgatactaacgttatcatc
gagggcaacgtgactctcggtcatcgcgtgaaaattggcaccggttgcgtgattaaaaac
agcgtgattggcgatgattgcgaaatcagtccgtataccgttgtggaagatgcgaatctg
gcagcggcctgtaccattggcccgtttgcccgtttgcgtcctggtgctgagttgctggaa
ggtgctcacgtcggtaacttcgttgagatgaaaaaagcgcgtctgggtaaaggctcgaaa
gctggtcatctgacttacctgggcgatgcggaaattggcgataacgttaacatcggcgcg
ggaaccattacctgcaactacgatggtgcgaataaatttaagaccattatcggcgacgat
gtgtttgttggttccgacactcagctggtggccccggtaacagtaggcaaaggcgcgacc
attgctgcgggtacaactgtgacgcgtaatgtcggcgaaaatgcattagctatcagccgt
gtgccgcagactcagaaagaaggctggcgtcgtccggtaaagaaaaagtga

DBGET integrated database retrieval system