KEGG   Escherichia coli K-12 MG1655: b3731Help
Entry
b3731             CDS       T00007                                 

Gene name
atpC
Definition
(RefSeq) F1 sector of membrane-bound ATP synthase, epsilon subunit (EC:3.6.3.14)
  KO
K02114  
F-type H+-transporting ATPase subunit epsilon
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b3731 (atpC)
Photosynthesis proteins [BR:eco00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   b3731 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3915553..3915972)
Genome map
AA seq 139 aa AA seqDB search
MAMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHE
EFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASA
ELAKAIAQLRVIELTKKAM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacttaccacctggacgtcgtcagcgcagagcaacaaatgttctctggtctg
gtcgagaaaatccaggtaacgggtagcgaaggtgaactggggatctaccctggccacgca
ccgctgctcaccgccattaagcctggtatgattcgcatcgtgaaacagcacggtcacgaa
gagtttatctatctgtctggcggcattcttgaagtgcagcctggcaacgtgaccgttctg
gccgacaccgcaattcgcggccaggatctcgacgaagcgcgagccatggaagcgaaacgt
aaggctgaagagcacattagcagctctcacggcgacgtagattacgctcaggcgtctgcg
gaactggccaaagcgatcgcgcagctgcgcgttatcgagttgaccaaaaaagcgatgtaa

DBGET integrated database retrieval system