KEGG   Escherichia coli K-12 MG1655: b3731Help
Entry
b3731             CDS       T00007                                 

Gene name
atpC
Definition
(RefSeq) F1 sector of membrane-bound ATP synthase, epsilon subunit
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00190  Oxidative phosphorylation
eco01100  Metabolic pathways
Module
eco_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    b3731 (atpC)
Photosynthesis proteins [BR:eco00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   b3731 (atpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Motif
Other DBs
NCBI-GeneID: 948245
NCBI-ProteinID: NP_418187
Pasteur: atpC
RegulonDB: ECK120000096
ECOCYC: EG10100
ASAP: ABE-0012206
UniProt: P0A6E6
Structure
PDB: 

Jmol
Position
complement(3915553..3915972)
Genome map
AA seq 139 aa AA seqDB search
MAMTYHLDVVSAEQQMFSGLVEKIQVTGSEGELGIYPGHAPLLTAIKPGMIRIVKQHGHE
EFIYLSGGILEVQPGNVTVLADTAIRGQDLDEARAMEAKRKAEEHISSSHGDVDYAQASA
ELAKAIAQLRVIELTKKAM
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgacttaccacctggacgtcgtcagcgcagagcaacaaatgttctctggtctg
gtcgagaaaatccaggtaacgggtagcgaaggtgaactggggatctaccctggccacgca
ccgctgctcaccgccattaagcctggtatgattcgcatcgtgaaacagcacggtcacgaa
gagtttatctatctgtctggcggcattcttgaagtgcagcctggcaacgtgaccgttctg
gccgacaccgcaattcgcggccaggatctcgacgaagcgcgagccatggaagcgaaacgt
aaggctgaagagcacattagcagctctcacggcgacgtagattacgctcaggcgtctgcg
gaactggccaaagcgatcgcgcagctgcgcgttatcgagttgaccaaaaaagcgatgtaa

DBGET integrated database retrieval system