KEGG   Escherichia coli K-12 MG1655: b3747Help
Entry
b3747             CDS       T00007                                 

Gene name
kup
Definition
(RefSeq) potassium transporter
  KO
K03549  
KUP system potassium uptake protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3747 (kup)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3931316..3933184
Genome map
AA seq 622 aa AA seqDB search
MSTDNKQSLPAITLAAIGVVYGDIGTSPLYTLRECLSGQFGFGVERDAVFGFLSLIFWLL
IFVVSIKYLTFVMRADNAGEGGILTLMSLAGRNTSARTTSMLVIMGLIGGSFFYGEVVIT
PAISVMSAIEGLEIVAPQLDTWIVPLSIIVLTLLFMIQKHGTAMVGKLFAPIMLTWFLIL
AGLGLRSIIANPEVLHALNPMWAVHFFLEYKTVSFIALGAVVLSITGVEALYADMGHFGK
FPIRLAWFTVVLPSLTLNYFGQGALLLKNPEAIKNPFFLLAPDWALIPLLIIAALATVIA
SQAVISGVFSLTRQAVRLGYLSPMRIIHTSEMESGQIYIPFVNWMLYVAVVIVIVSFEHS
SNLAAAYGIAVTGTMVLTSILSTTVARQNWHWNKYFVALILIAFLCVDIPLFTANLDKLL
SGGWLPLSLGTVMFIVMTTWKSERFRLLRRMHEHGNSLEAMIASLEKSPPVRVPGTAVYM
SRAINVIPFALMHNLKHNKVLHERVILLTLRTEDAPYVHNVRRVQIEQLSPTFWRVVASY
GWRETPNVEEVFHRCGLEGLSCRMMETSFFMSHESLILGKRPWYLRLRGKLYLLLQRNAL
RAPDQFEIPPNRVIELGTQVEI
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgataataagcaatcattgcccgcgattaccctcgcggcgattggagttgtc
tacggcgatattggtaccagcccgttatatacacttcgtgaatgtttgtccggccagttt
ggttttggcgttgaacgcgatgccgtgtttggctttttatcgctgatcttctggctgcta
atctttgtggtttccattaaatatctcaccttcgtgatgcgggcagataacgccggtgag
ggggggatcctgacgttgatgtcgcttgccgggcgtaatacgtcggcgcgaaccacatca
atgctggtgattatggggctaatcggcggcagctttttctatggtgaagtcgtcataaca
cccgctatttcggtgatgtcagccattgaaggtctggaaatcgtcgccccgcagctggat
acctggatagttcccctctcaattatcgttctcactttattatttatgattcaaaaacat
ggcacggctatggtcggtaagctgtttgcgccgatcatgctgacctggtttttgattctg
gcaggactggggttacgtagcattattgctaacccggaagtgctgcatgcgctgaatcca
atgtgggcggtgcatttcttccttgaatacaaaacggtttcttttattgcattaggggca
gtggtgttgtcgattacgggggtcgaggcgctgtatgctgatatggggcactttggtaag
ttccctattcgcctggcgtggttcaccgtcgtattaccttccttgacccttaattacttc
ggtcagggagcgctgttgttaaagaacccggaagcgattaagaacccgttcttcctgttg
gcaccggactgggcgctgatcccgctgctgatcatcgccgcactggcgacggtaattgcc
tcgcaggcggttatctctggcgtcttctcattgacgcgtcaggcggtacgtctgggatat
ttgtcgccgatgcgcattattcacacctccgaaatggagtcagggcaaatctatattccg
tttgtgaactggatgctctatgtcgcggtcgtgattgtgattgtcagctttgagcactcc
agcaacctggcggcggcgtacgggattgcggtgaccggaaccatggtgctgacgtctatt
ctctcgactaccgtggcacgtcagaactggcactggaataagtattttgttgcgctgatc
ctgattgctttcctttgtgtcgatattccattgttcaccgctaacctcgataaactgctc
tccggcggctggttgccattgagcctcggtactgtgatgtttatcgtgatgaccacctgg
aagagcgagcgtttccgcttgctgcggcggatgcatgaacatggtaactctctggaagcg
atgattgcttcgctggagaaatcaccgcctgttcgcgtgcccgggaccgcggtgtatatg
tcgcgtgcaatcaacgtcattccctttgcgctgatgcataaccttaaacataacaaggta
ttgcatgagcgggtgattctgttaactctgcgcaccgaagacgctccatatgtccataac
gtccgtcgggtacagattgaacaactgtcgcccactttctggcgcgtggtggcaagttat
ggttggcgagaaacgccaaacgtagaagaagttttccaccgctgcggtctggaaggatta
agttgccggatgatggaaacctccttctttatgtcgcatgagtcgttgatcctcggcaaa
cgcccgtggtatttgcgtctgcgcggcaagctgtacttgctgctgcaacgtaatgcgctg
cgtgcaccagatcaatttgaaatcccgccaaacagggttatcgaactgggtactcaggtc
gaaatctaa

DBGET integrated database retrieval system