KEGG   Escherichia coli K-12 MG1655: b3751Help
Entry
b3751             CDS       T00007                                 

Gene name
rbsB
Definition
(RefSeq) D-ribose transporter subunit
  KO
K10439  
ribose transport system substrate-binding protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
ABC transporters
Bacterial chemotaxis
Module
Ribose transport system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    b3751 (rbsB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    b3751 (rbsB)
Transporters [BR:eco02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Ribose transporter [MD:M00212] [OT]
    b3751 (rbsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
3936278..3937168
Genome map
AA seq 296 aa AA seqDB search
MNMKKLATLVSAVALSATVSANAMAKDTIALVVSTLNNPFFVSLKDGAQKEADKLGYNLV
VLDSQNNPAKELANVQDLTVRGTKILLINPTDSDAVGNAVKMANQANIPVITLDRQATKG
EVVSHIASDNVLGGKIAGDYIAKKAGEGAKVIELQGIAGTSAARERGEGFQQAVAAHKFN
VLASQPADFDRIKGLNVMQNLLTAHPDVQAVFAQNDEMALGALRALQTAGKSDVMVVGFD
GTPDGEKAVNDGKLAATIAQLPDQIGAKGVETADKVLKGEKVQAKYPVDLKLVVKQ
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaaaaaactggctaccctggtttccgctgttgcgctaagcgccaccgtcagt
gcgaatgcgatggcaaaagacaccatcgcgctggtggtctccacgcttaacaacccgttc
tttgtatcgctgaaagatggcgcgcagaaagaggcggataaacttggctataacctggtg
gtgctggactcccagaacaacccggcgaaagagctggcgaacgtgcaggacttaaccgtt
cgcggcacaaaaattctgctgattaacccgaccgactccgacgcagtgggtaatgctgtg
aagatggctaaccaggcgaacatcccggttatcactcttgaccgccaggcaacgaaaggt
gaagtggtgagccacattgcttctgataacgtactgggcggcaaaatcgctggtgattac
atcgcgaagaaagcgggtgaaggtgccaaagttatcgagctgcaaggcattgctggtaca
tccgcagcccgtgaacgtggcgaaggcttccagcaggccgttgctgctcacaagtttaat
gttcttgccagccagccagcagattttgatcgcattaaaggtttgaacgtaatgcagaac
ctgttgaccgctcatccggatgttcaggctgtattcgcgcagaatgatgaaatggcgctg
ggcgcgctgcgcgcactgcaaactgccggtaaatcggatgtgatggtcgtcggatttgac
ggtacaccggatggcgaaaaagcggtgaatgatggcaaactagcagcgactatcgctcag
ctacccgatcagattggcgcgaaaggcgtcgaaaccgcagataaagtgctgaaaggcgag
aaagttcaggctaagtatccggttgatctgaaactggttgttaagcagtag

DBGET integrated database retrieval system