KEGG   Escherichia coli K-12 MG1655: b3765Help
Entry
b3765             CDS       T00007                                 

Gene name
yifB
Definition
(RefSeq) bifunctional magnesium chelatase family protein and putative transcriptional regulator
  KO
K07391  
magnesium chelatase family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(3948449..3949969)
Genome map
AA seq 506 aa AA seqDB search
MSLSIVHTRAALGVNAPPITVEVHISKGLPGLTMVGLPETTVKEARDRVRSAIINSGYEY
PAKKITINLAPADLPKEGGRYDLPIAIALLAASEQLTANKLDEYELVGELALTGALRGVP
GAISSATEAIKSGRKIIVAKDNEDEVGLINGEGCLIADHLQAVCAFLEGKHALERPKPTD
AVSRALQHDLSDVIGQEQGKRGLEITAAGGHNLLLIGPPGTGKTMLASRINGLLPDLSNE
EALESAAILSLVNAESVQKQWRQRPFRSPHHSASLTAMVGGGAIPGPGEISLAHNGVLFL
DELPEFERRTLDALREPIESGQIHLSRTRAKITYPARFQLVAAMNPSPTGHYQGNHNRCT
PEQTLRYLNRLSGPFLDRFDLSLEIPLPPPGILSKTVVPGESSATVKQRVMAARERQFKR
QNKLNAWLDSPEIRQFCKLESEDAMWLEGTLIHLGLSIRAWQRLLKVARTIADIDQSDII
TRQHLQEAVSYRAIDRLLIHLQKLLT
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgtcaattgttcatacccgcgcagccctgggagtaaatgcgcccccgatcact
gttgaggtacatatcagtaaaggtctacccggcttaacgatggtgggcttaccagaaaca
acggtaaaagaagctcgcgatcgcgtgcgcagcgccattatcaatagcggatatgaatat
ccggcgaaaaaaatcaccatcaacctggctccagctgatctgccaaaagaagggggacga
tatgatttacctatcgccattgcgttgctggcggcctcagaacagcttacagccaataag
ttagatgaatatgaattagtcggagaactggcgcttacaggcgctctgcgtggcgttccc
ggcgcaatctccagtgcaactgaagctattaagtcgggcagaaaaattatcgtcgcgaaa
gataacgaagatgaagtggggctaattaacggtgaaggatgcctgatagccgatcatctg
caagctgtctgtgcgtttctggaaggtaagcacgctctcgaacgcccgaaaccaactgat
gcagtatcccgggcgctacaacatgatctcagtgatgttatcggtcaggaacaaggaaag
cgaggactggaaattaccgctgctggcgggcacaaccttttactgattgggccgccggga
acaggtaaaacaatgctcgccagccgtattaatggcctgttgccagatttaagcaatgaa
gaggcactggagagtgctgcgatattaagtctggtaaatgctgaatcagtacaaaaacaa
tggcggcagcgcccgttccgctcacctcatcacagtgcatcgttaactgcgatggtaggc
ggtggcgcaattccagggcccggtgaaatttcgctggcgcataacggcgtgctttttctt
gatgagctacctgaatttgaacggcgtacactggatgccttgcgagagccgattgaatcc
gggcagatccatctttcacgcacacgagcaaaaataacctatccagcccgtttccagctt
gttgcggcgatgaatcccagccctaccggacattatcagggaaaccataaccgctgcacg
ccagaacagacattacgttatctcaaccggctctcggggccctttctcgaccgcttcgat
ctctcactggagatcccattaccaccccccggcattttgagtaaaacggtagtgccggga
gaaagcagcgccaccgttaaacaacgcgtaatggccgccagagagcgccaatttaagcgg
cagaataaactgaatgcctggctggatagtccggaaatacgccaattctgcaaacttgag
agcgaagatgcgatgtggttggaaggaacactgatccatctggggttatcgattcgtgcc
tggcagcggttattgaaagttgcacgaaccattgctgatattgatcagtctgacattatc
acacgtcagcatttgcaggaggcagttagctatcgagcgattgaccgtttgctcatccat
ctgcagaaactactgacataa

DBGET integrated database retrieval system