KEGG   Escherichia coli K-12 MG1655: b3771Help
Entry
b3771             CDS       T00007                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxyacid dehydratase (EC:4.2.1.9)
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    b3771 (ilvD)
   01230 Biosynthesis of amino acids
    b3771 (ilvD)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    b3771 (ilvD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b3771 (ilvD)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     b3771 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3953478..3955328
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV
ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQDARGDKAWTPKNRERQVSFALRAYASLA
TSADKGAVRDKSKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcg
ctgtggcgcgccaccggaatgaccgacgccgatttcggtaagccgattatcgcggttgtg
aactcgttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtc
gccgaacaaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggat
gatgggattgccatgggccacggggggatgctttattcactgccatctcgcgaactgatc
gctgattccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctct
aactgcgacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtg
atctttgtttccggcggcccgatggaggccgggaaaaccaaactttccgatcagatcatc
aagctcgatctggttgatgcgatgatccagggcgcagacccgaaagtatctgactcccag
agcgatcaggttgaacgttccgcgtgtccgacctgcggttcctgctccgggatgtttacc
gctaactcaatgaactgcctgaccgaagcgctgggcctgtcgcagccgggcaacggctcg
ctgctggcaacccacgccgaccgtaagcagctgttccttaatgctggtaaacgcattgtt
gaattgaccaaacgttattacgagcaaaacgacgaaagtgcactgccgcgtaatatcgcc
agtaaggcggcgtttgaaaacgccatgacgctggatatcgcgatgggtggatcgactaac
accgtacttcacctgctggcggcggcgcaggaagcggaaatcgacttcaccatgagtgat
atcgataagctttcccgcaaggttccacagctgtgtaaagttgcgccgagcacccagaaa
taccatatggaagatgttcaccgtgctggtggtgttatcggtattctcggcgaactggat
cgcgcggggttactgaaccgtgatgtgaaaaacgtacttggcctgacgttgccgcaaacg
ctggaacaatacgacgttatgctgacccaggatgacgcggtaaaaaatatgttccgcgca
ggtcctgcaggcattcgtaccacacaggcattctcgcaagattgccgttgggatacgctg
gacgacgatcgcgccaatggctgtatccgctcgctggaacacgcctacagcaaagacggc
ggcctggcggtgctctacggtaactttgcggaaaacggctgcatcgtgaaaacggcaggc
gtcgatgacagcatcctcaaattcaccggcccggcgaaagtgtacgaaagccaggacgat
gcggtagaagcgattctcggcggtaaagttgtcgccggagatgtggtagtaattcgctat
gaaggcccgaaaggcggtccggggatgcaggaaatgctctacccaaccagcttcctgaaa
tcaatgggtctcggcaaagcctgtgcgctgatcaccgacggtcgtttctctggtggcacc
tctggtctttccatcggccacgtctcaccggaagcggcaagcggcggcagcattggcctg
attgaagatggtgacctgatcgctatcgacatcccgaaccgtggcattcagttacaggta
agcgatgccgaactggcggcgcgtcgtgaagcgcaggacgctcgaggtgacaaagcctgg
acgccgaaaaatcgtgaacgtcaggtctcctttgccctgcgtgcttatgccagcctggca
accagcgccgacaaaggcgcggtgcgcgataaatcgaaactggggggttaa

DBGET integrated database retrieval system