KEGG   Escherichia coli K-12 MG1655: b3771Help
Entry
b3771             CDS       T00007                                 

Gene name
ilvD
Definition
(RefSeq) dihydroxyacid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:eco00001]
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    b3771 (ilvD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    b3771 (ilvD)
Enzymes [BR:eco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     b3771 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RegulonDB: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3953478..3955328
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDQIIKLDLVDAMIQGADPKVSDSQ
SDQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKQLFLNAGKRIV
ELTKRYYEQNDESALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGLLNRDVKNVLGLTLPQT
LEQYDVMLTQDDAVKNMFRAGPAGIRTTQAFSQDCRWDTLDDDRANGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVAGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGSIGL
IEDGDLIAIDIPNRGIQLQVSDAELAARREAQDARGDKAWTPKNRERQVSFALRAYASLA
TSADKGAVRDKSKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtaccgttccgccaccaccactcatggtcgtaatatggcgggtgctcgtgcg
ctgtggcgcgccaccggaatgaccgacgccgatttcggtaagccgattatcgcggttgtg
aactcgttcacccaatttgtaccgggtcacgtccatctgcgcgatctcggtaaactggtc
gccgaacaaattgaagcggctggcggcgttgccaaagagttcaacaccattgcggtggat
gatgggattgccatgggccacggggggatgctttattcactgccatctcgcgaactgatc
gctgattccgttgagtatatggtcaacgcccactgcgccgacgccatggtctgcatctct
aactgcgacaaaatcaccccggggatgctgatggcttccctgcgcctgaatattccggtg
atctttgtttccggcggcccgatggaggccgggaaaaccaaactttccgatcagatcatc
aagctcgatctggttgatgcgatgatccagggcgcagacccgaaagtatctgactcccag
agcgatcaggttgaacgttccgcgtgtccgacctgcggttcctgctccgggatgtttacc
gctaactcaatgaactgcctgaccgaagcgctgggcctgtcgcagccgggcaacggctcg
ctgctggcaacccacgccgaccgtaagcagctgttccttaatgctggtaaacgcattgtt
gaattgaccaaacgttattacgagcaaaacgacgaaagtgcactgccgcgtaatatcgcc
agtaaggcggcgtttgaaaacgccatgacgctggatatcgcgatgggtggatcgactaac
accgtacttcacctgctggcggcggcgcaggaagcggaaatcgacttcaccatgagtgat
atcgataagctttcccgcaaggttccacagctgtgtaaagttgcgccgagcacccagaaa
taccatatggaagatgttcaccgtgctggtggtgttatcggtattctcggcgaactggat
cgcgcggggttactgaaccgtgatgtgaaaaacgtacttggcctgacgttgccgcaaacg
ctggaacaatacgacgttatgctgacccaggatgacgcggtaaaaaatatgttccgcgca
ggtcctgcaggcattcgtaccacacaggcattctcgcaagattgccgttgggatacgctg
gacgacgatcgcgccaatggctgtatccgctcgctggaacacgcctacagcaaagacggc
ggcctggcggtgctctacggtaactttgcggaaaacggctgcatcgtgaaaacggcaggc
gtcgatgacagcatcctcaaattcaccggcccggcgaaagtgtacgaaagccaggacgat
gcggtagaagcgattctcggcggtaaagttgtcgccggagatgtggtagtaattcgctat
gaaggcccgaaaggcggtccggggatgcaggaaatgctctacccaaccagcttcctgaaa
tcaatgggtctcggcaaagcctgtgcgctgatcaccgacggtcgtttctctggtggcacc
tctggtctttccatcggccacgtctcaccggaagcggcaagcggcggcagcattggcctg
attgaagatggtgacctgatcgctatcgacatcccgaaccgtggcattcagttacaggta
agcgatgccgaactggcggcgcgtcgtgaagcgcaggacgctcgaggtgacaaagcctgg
acgccgaaaaatcgtgaacgtcaggtctcctttgccctgcgtgcttatgccagcctggca
accagcgccgacaaaggcgcggtgcgcgataaatcgaaactggggggttaa

DBGET integrated database retrieval system