KEGG   Escherichia coli K-12 MG1655: b3775Help
Entry
b3775             CDS       T00007                                 

Gene name
ppiC
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase C (rotamase C) (EC:5.2.1.8)
  KO
K03769  
peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     b3775 (ppiC)
Chaperones and folding catalysts [BR:eco03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    b3775 (ppiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3959532..3959813)
Genome map
AA seq 93 aa AA seqDB search
MAKTAAALHILVKEEKLALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVP
AFDKVVFSCPVLEPTGPLHTQFGYHIIKVLYRN
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagcagcagcactgcatatccttgtaaaagaagagaaactggctctggat
cttctcgagcagattaagaacggggccgatttcggcaagctggcgaagaaacactccatt
tgcccatcaggcaaacgcggcggtgatttaggtgaattccgccagggtcagatggttccg
gcgttcgataaagtggttttctcttgtccggtactggagccgaccggcccgctgcacacc
cagttcggatatcacatcattaaggtgctgtaccgcaactaa

DBGET integrated database retrieval system