KEGG   Escherichia coli K-12 MG1655: b3806Help
Entry
b3806             CDS       T00007                                 

Gene name
cyaA
Definition
(RefSeq) adenylate cyclase (EC:4.6.1.1)
  KO
K05851  
adenylate cyclase, class 1 [EC:4.6.1.1]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b3806 (cyaA)
Enzymes [BR:eco01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     b3806 (cyaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
3991153..3993699
Genome map
AA seq 848 aa AA seqDB search
MYLYIETLKQRLDAINQLRVDRALAAMGPAFQQVYSLLPTLLHYHHPLMPGYLDGNVPKG
ICLYTPDETQRHYLNELELYRGMSVQDPPKGELPITGVYTMGSTSSVGQSCSSDLDIWVC
HQSWLDSEERQLLQRKCSLLENWAASLGVEVSFFLIDENRFRHNESGSLGGEDCGSTQHI
LLLDEFYRTAVRLAGKRILWNMVPCDEEEHYDDYVMTLYAQGVLTPNEWLDLGGLSSLSA
EEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNPRLLAKDIKQRLHDGEIVSFGLD
PYCMMLERVTEYLTAIEDFTRLDLVRRCFYLKVCEKLSRERACVGWRRAVLSQLVSEWGW
DEARLAMLDNRANWKIDQVREAHNELLDAMMQSYRNLIRFARRNNLSVSASPQDIGVLTR
KLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPPGRANRSGWYLYNRAPNIESIISHQ
PLEYNRYLNKLVAWAWFNGLLTSRTRLYIKGNGIVDLPKLQEMVADVSHHFPLRLPAPTP
KALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFRKLDVFSFGENQNCLVGSVDLLYRN
SWNEVRTLHFNGEQSMIEALKTILGKMHQDAAPPDSVEVFCYSQHLRGLIRTRVQQLVSE
CIELRLSSTRQETGRFKALRVSGQTWGLFFERLNVSVQKLENAIEFYGAISHNKLHGLSV
QVETNHVKLPAVVDGFASEGIIQFFFEETQDENGFNIYILDESNRVEVYHHCEGSKEELV
RDVSRFYSSSHDRFTYGSSFINFNLPQFYQIVKVDGREQVIPFRTKSIGNMPPANQDHDT
PLLQQYFS
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
ttgtacctctatattgagactctgaaacagagactggatgccataaatcaattgcgtgtg
gatcgcgcgcttgctgctatggggcctgcattccaacaggtctacagtctactgccgaca
ttgttgcactatcaccatccgctaatgccgggttaccttgatggtaacgttcccaaaggc
atttgcctttacacgcctgatgaaactcaacgccactacctgaacgagcttgaactgtat
cgtggaatgtcagtacaggatccgccgaaaggtgagcttccaattactggtgtatacacc
atgggcagcacctcgtccgtagggcaaagttgttcctctgacctggatatctgggtctgt
catcaatcctggctcgatagcgaagagcgccaattgctacaacgtaaatgtagcctgctg
gaaaactgggccgcctcgctgggtgtggaagtcagcttcttcctgattgatgaaaaccgc
ttccgtcataatgaaagcggcagcctggggggcgaagattgtggctccacccagcatata
ctgctgcttgacgaattttatcgtaccgccgtgcgtctcgccggtaagcgtattctgtgg
aatatggtgccgtgcgacgaagaagagcattacgacgactatgtgatgacgctttacgcg
cagggcgtgctgacgccaaatgaatggctggatctcggtggcttaagctcgctttctgct
gaagagtactttggtgccagcctttggcagctctacaagagtatcgattccccatacaaa
gcggtactgaaaacactgctgctggaagcctattcctgggaatacccgaacccacgtctg
ctggcgaaagatatcaaacagcgtttgcacgacggcgagattgtatcgtttggtctcgat
ccatactgcatgatgctggagcgtgttactgaatacctgacggcgattgaagattttacc
cgtctggatttagtacgtcgctgcttctatttaaaagtgtgcgaaaagctcagccgtgaa
cgcgcctgcgtaggctggcgtcgcgcagtgttgagccagttagtgagcgagtggggttgg
gacgaagctcgtctggcaatgctcgataaccgcgctaactggaagattgatcaggtgcgt
gaggcgcacaacgagttgctcgacgcgatgatgcagagctaccgtaatctgatccgcttt
gcgcgtcgcaataaccttagcgtctccgccagtccgcaggatatcggcgtgctgacgcgt
aagctgtatgccgcgtttgaagcattaccaggtaaagtgacgctggtaaacccgcagatt
tcacccgatctctcggaaccgaatctgacctttatttatgtgccgccgggccgggctaac
cgttcaggttggtatctgtataaccgcgcgccaaatattgagtcgatcatcagccatcag
ccgctggaatataaccgttacctgaataaactggtggcgtgggcatggtttaacggcctg
ctgacctcgcgcacccgtttgtatattaaaggtaacggcattgtcgatttgcctaagttg
caggagatggtcgccgacgtgtcgcaccatttcccgctgcgcttacctgcaccgacaccg
aaggcgctctacagcccgtgtgagatccgccatctggcgattatcgttaacctggaatat
gacccgacagcggcgttccgcaatcaggtggtgcatttcgatttccgtaagctggatgtc
ttcagctttggcgagaatcaaaattgcctggtaggtagcgttgacctgctgtaccgcaac
tcgtggaacgaagtgcgtacgctgcacttcaacggcgagcaatcgatgatcgaagccctg
aaaactattctcggcaaaatgcatcaggacgccgcaccgccagatagcgtggaagtcttc
tgttatagccagcatctgcgcggcttaattcgtactcgcgtgcagcaactggtttctgag
tgtattgaattgcgtctttccagcacccgccaggaaaccgggcgtttcaaggcgctgcgc
gtttctggtcaaacctgggggttgttcttcgaacgcctgaatgtatcggtacagaaactg
gaaaacgccatcgagttttatggcgcgatttcgcataacaaactgcacggcctgtcagtg
caggttgaaaccaatcacgtcaaattaccggcggtggtggacggctttgccagcgaaggg
atcatccagttctttttcgaagaaacgcaagacgagaatggctttaatatctacattctc
gacgaaagcaaccgggttgaggtatatcaccactgcgaaggcagcaaagaggagctggta
cgtgacgtcagtcgcttctactcgtcatcgcatgaccgttttacctacggctcaagcttc
atcaacttcaacctgccgcagttctatcagattgtgaaggttgatggtcgtgaacaggtg
attccgttccgcacaaaatctatcggtaacatgccgcctgccaatcaggatcacgatacg
ccgctattacagcaatatttttcgtga

DBGET integrated database retrieval system