KEGG   Escherichia coli K-12 MG1655: b3823Help
Entry
b3823             CDS       T00007                                 

Gene name
rhtC
Definition
(RefSeq) threonine efflux pump
  KO
K05835  
threonine efflux protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3823 (rhtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4007757..4008377
Genome map
AA seq 206 aa AA seqDB search
MLMLFLTVAMVHIVALMSPGPDFFFVSQTAVSRSRKEAMMGVLGITCGVMVWAGIALLGL
HLIIEKMAWLHTLIMVGGGLYLCWMGYQMLRGALKKEAVSAPAPQVELAKSGRSFLKGLL
TNLANPKAIIYFGSVFSLFVGDNVGTTARWGIFALIIVETLAWFTVVASLFALPQMRRGY
QRLAKWIDGFAGALFAGFGIHLIISR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgttatttctcaccgtcgccatggtgcacattgtggcgcttatgagccccggt
cccgatttcttttttgtctctcagaccgctgtcagtcgttcccgtaaagaagcgatgatg
ggcgtgctgggcattacctgcggcgtaatggtttgggctgggattgcgctgcttggcctg
catttgattatcgaaaaaatggcctggctgcatacgctgattatggtgggcggtggcctg
tatctctgctggatgggttaccagatgctacgtggtgcactgaaaaaagaggcggtttct
gcacctgcgccacaggtcgagctggcgaaaagtgggcgcagtttcctgaaaggtttactg
accaatctcgctaatccgaaagcgattatctactttggctcggtgttctcattgtttgtc
ggtgataacgttggcactaccgcgcgctggggcatttttgcgctgatcattgtcgaaacg
ctggcgtggtttaccgtcgttgccagcctgtttgccctgccgcaaatgcgccgtggttat
caacgtctggcgaagtggattgatggttttgccggggcgttatttgccggatttggcatt
catttgattatttcgcggtga

DBGET integrated database retrieval system