KEGG   Escherichia coli K-12 MG1655: b3824Help
Entry
b3824             CDS       T00007                                 

Gene name
rhtB
Definition
(RefSeq) homoserine, homoserine lactone and S-methyl-methionine efflux pump
  KO
K05834  
homoserine/homoserine lactone efflux protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3824 (rhtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4008439..4009059)
Genome map
AA seq 206 aa AA seqDB search
MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG
LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL
TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK
QMKALNKIFGSLFMLVGALLASARHA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagaatggtggtttgcctacctgctgacatcgatcattttaagcctgtcgcca
ggctctggtgcaatcaacactatgaccacctcgctcaaccacggttatcgcggcgcggtg
gcgtctattgctgggcttcagaccggactggcgattcatattgtgctggttggcgtgggg
ttggggacgctattttcccgctcagtgattgcgtttgaagtgttgaagtgggcaggcgcg
gcttacttgatttggctgggaatccagcagtggcgcgccgctggtgcaattgaccttaaa
tcgctggcctctactcaatcgcgtcgacatttgttccagcgcgcagtttttgtgaatctc
accaatcccaaaagtattgtgtttctggcggcgctatttccgcaattcatcatgccgcaa
cagccgcaactgatgcagtatatcgtgctcggcgtcaccactattgtggtcgatattatt
gtgatgatcggttacgccacccttgctcaacggattgctctatggattaaaggaccaaag
cagatgaaggcgctgaataagattttcggctcgttgtttatgctggtgggagcgctgtta
gcatcggcgaggcatgcgtga

DBGET integrated database retrieval system