KEGG   Escherichia coli K-12 MG1655: b3839Help
Entry
b3839             CDS       T00007                                 

Gene name
tatC
Definition
TatABCE protein translocation system subunit
Orthology
K03118  
sec-independent protein translocase protein TatC
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Protein export
Bacterial secretion system
Module
Twin-arginine translocation (Tat) system
Class
Genetic Information Processing; Folding, sorting and degradation; Protein export [PATH:eco03060]
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:eco03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4022736..4023512
Genome map
AA seq 258 aa AA seqDB search
MSVEDTQPLITHLIELRKRLLNCIIAVIVIFLCLVYFANDIYHLVSAPLIKQLPQGSTMI
ATDVASPFFTPIKLTFMVSLILSAPVILYQVWAFIAPALYKHERRLVVPLLVSSSLLFYI
GMAFAYFVVFPLAFGFLANTAPEGVQVSTDIASYLSFVMALFMAFGVSFEVPVAIVLLCW
MGITSPEDLRKKRPYVLVGAFVVGMLLTPPDVFSQTLLAIPMYCLFEIGVFFSRFYVGKG
RNREEENDAEAESEKTEE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaagatactcaaccgcttatcacgcatctgattgagctgcgtaagcgtctg
ctgaactgcattatcgcggtgatcgtgatattcctgtgtctggtctatttcgccaatgac
atctatcacctggtatccgcgccattgatcaagcagttgccgcaaggttcaacgatgatc
gccaccgacgtggcctcgccgttctttacgccgatcaagctgacctttatggtgtcgctg
attctgtcagcgccggtgattctctatcaggtgtgggcatttatcgccccagcgctgtat
aagcatgaacgtcgcctggtggtgccgctgctggtttccagctctctgctgttttatatc
ggcatggcattcgcctactttgtggtctttccgctggcatttggcttccttgccaatacc
gcgccggaaggggtgcaggtatccaccgacatcgccagctatttaagcttcgttatggcg
ctgtttatggcgtttggtgtctcctttgaagtgccggtagcaattgtgctgctgtgctgg
atggggattacctcgccagaagacttacgcaaaaaacgcccgtatgtgctggttggtgca
ttcgttgtcgggatgttgctgacgccgccggatgtcttctcgcaaacgctgttggcgatc
ccgatgtactgtctgtttgaaatcggtgtcttcttctcacgcttttacgttggtaaaggg
cgaaatcgggaagaggaaaacgacgctgaagcagaaagcgaaaaaactgaagaataa

DBGET integrated database retrieval system