KEGG   Escherichia coli K-12 MG1655: b3847Help
Entry
b3847             CDS       T00007                                 

Gene name
pepQ
Definition
(RefSeq) proline dipeptidase (EC:3.4.13.9)
  KO
K01271  
Xaa-Pro dipeptidase [EC:3.4.13.9]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.13  Dipeptidases
    3.4.13.9  Xaa-Pro dipeptidase
     b3847 (pepQ)
Peptidases [BR:eco01002]
 Metallo Peptidases
  Family M24
   b3847 (pepQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4031161..4032492
Genome map
AA seq 443 aa AA seqDB search
MESLASLYKNHIATLQERTRDALARFKLDALLIHSGELFNVFLDDHPYPFKVNPQFKAWV
PVTQVPNCWLLVDGVNKPKLWFYLPVDYWHNVEPLPTSFWTEDVEVIALPKADGIGSLLP
AARGNIGYIGPVPERALQLGIEASNINPKGVIDYLHYYRSFKTEYELACMREAQKMAVNG
HRAAEEAFRSGMSEFDINIAYLTATGHRDTDVPYSNIVALNEHAAVLHYTKLDHQAPEEM
RSFLLDAGAEYNGYAADLTRTWSAKSDNDYAQLVKDVNDEQLALIATMKAGVSYVDYHIQ
FHQRIAKLLRKHQIITDMSEEAMVENDLTGPFMPHGIGHPLGLQVHDVAGFMQDDSGTHL
AAPAKYPYLRCTRILQPGMVLTIEPGIYFIESLLAPWREGQFSKHFNWQKIEALKPFGGI
RIEDNVVIHENNVENMTRDLKLA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaatcactggcctcgctctataaaaatcatatagctaccttacaagaacggactcgc
gatgcgctggcgcgcttcaagctggatgcgttacttattcactccggcgagctgttcaat
gtttttctcgacgatcatccctatccgtttaaagtgaacccgcaattcaaagcgtgggtg
ccggtaactcaggtgccaaactgctggttgctggtggatggcgtgaacaagccgaaactg
tggttctatctgccggttgattactggcacaacgtcgaaccgctgccgacctctttctgg
actgaagatgtggaagtgatcgcgctgccgaaagccgatggcattggtagcctgctgcct
gctgcgcgcggcaatatcggttatatcggtccggtgccggaacgtgcgctgcaactgggt
attgaggccagcaacatcaacccgaaaggggttatcgactacctgcattactatcgctcc
ttcaaaactgagtacgaactggcctgtatgcgtgaagcgcagaaaatggcggtcaacggt
caccgcgcggcagaagaagcgttccgttctggcatgagcgagttcgatatcaacattgcc
tatctgaccgcgaccggtcatcgtgataccgacgtaccttacagcaacattgtggcgctt
aacgaacacgctgcggtactgcattacaccaaactggaccatcaggcaccggaagagatg
cgcagcttcctgctggatgccggggcagaatataacggctatgcggctgacctgacccgt
acctggtcggcaaaaagtgacaacgactacgcgcagctggtgaaggacgttaatgatgaa
caactggcgctgatcgccaccatgaaagcaggcgtcagctatgtggattaccacatccag
ttccatcagcgcatcgccaaactgctgcgtaaacatcaaatcatcaccgatatgagtgaa
gaagcgatggtcgaaaacgatcttaccgggccgtttatgccgcatggtatcggccatccg
ctgggcctgcaggtgcatgacgtcgctggttttatgcaggatgatagcggtacgcacctc
gcggcaccggcaaaatatccgtacctgcgctgcacccgtattctccagccgggcatggtg
ttaaccatcgaaccgggtatctacttcatcgaatcgctactggcaccgtggcgtgaaggg
cagttcagcaagcacttcaactggcagaaaattgaagcactgaaaccgttcggcggcatt
cgtatcgaagacaacgtggtgatccacgaaaacaacgtggaaaacatgacccgggatctg
aaactggcgtga

DBGET integrated database retrieval system