KEGG   Escherichia coli K-12 MG1655: b3867Help
Entry
b3867             CDS       T00007                                 

Gene name
hemN
Definition
(RefSeq) coproporphyrinogen III oxidase, SAM and NAD(P)H dependent, oxygen-independent (EC:1.3.99.22)
  KO
K02495  
oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    b3867 (hemN)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     b3867 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4052045..4053418
Genome map
AA seq 457 aa AA seqDB search
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVA
QREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRG
IALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDLHFADYFAEDLKLLAPLAKDGLVDVDE
KGIQVTAKGRLLIRNICMCFDTYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacagcaaatcgactgggatctggccctgatccagaaatataactattccggg
ccacgatacacctcgtacccgaccgcgctggagttttcagaagacttcggcgaacaggcg
tttttacaagccgtggcgcgctatcctgagcgtccattatctctctacgtacatatcccg
ttctgccataagctttgttacttctgcggttgcaataagattgttactcgccagcagcac
aaggccgatcagtatctggacgcgctggagcaagaaatcgtccatcgtgcaccgctgttc
gccgggcgtcacgtcagccaattgcactggggcggcggaacgccgacgtatctgaataaa
gcgcaaatcagccgcctgatgaagctgctgcgcgaaaacttccagttcaatgccgatgcg
gagatttcgatcgaagtcgatccgcgggaaatcgaactggatgtactcgatcatttacgc
gccgaaggctttaatcgcctgagcatgggcgtgcaggacttcaacaaagaagtgcaacgt
ctggttaaccgcgagcaggatgaagagttcatctttgcactgcttaaccatgcgcgtgag
attggttttacctccaccaacatcgacctgatttacggcctgccgaaacagacgccggag
agtttcgcctttaccctgaaacgtgtggcggagctgaaccccgatcgtctgagtgtcttt
aactacgcgcatctgccgaccatttttgctgctcagcgcaaaatcaaagatgctgacctg
ccgagtccgcagcaaaaactcgatatcctgcaggaaaccatcgccttcctgacgcaatcg
ggctatcagtttatcggtatggatcactttgcccgtccggatgacgagctggcggtggcc
cagcgtgaaggcgtgctgcatcgtaacttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttccgccatcagcatgattggcgactgctacgcgcagaaccag
aaagagttgaagcagtactatcagcaagtggatgaacaaggcaatgcgctgtggcgtggt
attgcgctaacgcgtgatgactgtattcgccgcgatgtgattaagtcgctcatctgcaac
ttccgtctggattacgcccctattgagaaacagtgggatttgcacttcgctgattacttt
gcggaagatctcaagctgctcgccccgttagcaaaagatgggctggtggatgtggatgag
aagggaatacaggtgacggcgaaaggtcgcttgctgatccgcaacatttgcatgtgcttt
gatacctatctgcgccagaaagcgcggatgcagcagttctctcgggtgatttaa

DBGET integrated database retrieval system