KEGG   Escherichia coli K-12 MG1655: b3868Help
Entry
b3868             CDS       T00007                                 

Gene name
glnG
Definition
(RefSeq) fused DNA-binding response regulator in two-component regulatory system with GlnL: response regulator/sigma54 interaction protein
  KO
K07712  
two-component system, NtrC family, nitrogen regulation response regulator GlnG
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Two-component system
Module
GlnL-GlnG (nitrogen regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:eco00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    b3868 (glnG)
Two-component system [BR:eco02022]
 NtrC family
  GlnL-GlnG [MD:M00497]
   b3868 (glnG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4053869..4055278)
Genome map
AA seq 469 aa AA seqDB search
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGM
DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYQEQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHA
LHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDE
IGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHR
LNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQL
ENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQMQPDSWATLLAQWADRALRSGHQN
LLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgagggatagtctgggtagtcgatgacgatagttccatccgttgggtgcttgaa
cgtgcgctcgctggggcaggtttaacctgtacgacgtttgagaacggcgcagaagtgctg
gaggcgctggcgagcaaaacgccggatgtgctgctttcagatatccgtatgccgggaatg
gacgggctggcgctgctcaagcagattaaacagcgccatccaatgcttccggtcatcatt
atgaccgcacattccgatctggatgctgccgtcagcgcctatcaacaaggggcgtttgat
tatctgcccaaaccgtttgatatcgacgaagcagtggcgctggttgagcgcgctatcagt
cattaccaggaacagcagcagccgcgtaatgttcagcttaacggcccaacgaccgatatc
atcggcgaagcgccagccatgcaggacgtgttccgtattatcggtcggctttcgcgttct
tctattagcgtgctgattaacggcgaatccggcaccggtaaagaactggtcgctcatgcc
ctgcatcgccacagtccgcgcgccaaagcgccgtttatcgcgctgaatatggcagctatc
ccaaaagatttgatcgaatcagaactgtttggccacgagaaaggcgcgtttactggcgcg
aataccattcgtcaggggcgttttgaacaggccgatggcggtacattattcctcgacgaa
attggtgatatgccgctggatgtgcagacgcgtttgctgcgcgtgctggcagacggtcag
ttttaccgcgttggcggctatgcgccggtgaaagtggatgtgcggattatcgctgccact
caccagaatctcgaacagcgagtgcaggaaggtaagttccgtgaggatctgttccaccgc
ctgaacgttatccgcgttcatctgccgccgctgcgcgaacgtcgggaagatattccccgt
ctggcgcgccattttttacaggttgccgcgcgcgaactgggcgtagaagcgaagttactg
catccggaaaccgaagctgctctgacgcgtctggcgtggccaggcaacgtgcgccagctg
gaaaacacctgccgctggctaacggtgatggccgccgggcaggaagtgttgattcaggat
ttgcccggcgaactgtttgaatcaacggttgcggagagtacttcgcaaatgcaaccggac
agctgggcgacgcttcttgcgcagtgggcagacagagcgctgcgttccggtcatcaaaat
ctgctttccgaagcgcagccagagctggagcggacgttactgacgaccgcgttgcgacat
acgcaggggcataaacaggaagcggcgcggctactcggctggggccgcaacaccctgacg
cgtaagttaaaagagctggggatggagtga

DBGET integrated database retrieval system