KEGG   Escherichia coli K-12 MG1655: b3877Help
Entry
b3877             CDS       T00007                                 

Gene name
yihP
Definition
(RefSeq) putative transporter
  KO
K03292  
glycoside/pentoside/hexuronide:cation symporter, GPH family
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4065809..4067194)
Genome map
AA seq 461 aa AA seqDB search
MSHITTEDPATLRLPFKEKLSYGIGDLASNILLDIGTLYLLKFYTDVLGLPGTYGGIIFL
ISKFFTAFTDMGTGIMLDSRRKIGPKGKFRPFILYASFPVTLLAIANFVGTPFDVTGKTV
MATILFMLYGLFFSMMNCSYGAMVPAITKNPNERASLAAWRQGGATLGLLLCTVGFVPVM
NLIEGNQQLGYIFAATLFSLFGLLFMWICYSGVKERYVETQPANPAQKPGLLQSFRAIAG
NRPLFILCIANLCTLGAFNVKLAIQVYYTQYVLNDPILLSYMGFFSMGCIFIGVFLMPAS
VRRFGKKKVYIGGLLIWVLGDLLNYFFGGGSVSFVAFSCLAFFGSAFVNSLNWALVSDTV
EYGEWRTGVRSEGTVYTGFTFFRKVSQALAGFFPGWMLTQIGYVPNVAQADHTIEGLRQL
IFIYPSALAVVTIVAMGCFYSLNEKMYVRIVEEIEARKRTA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacatcacaacggaagatccagcaactttacgcctgccctttaaagagaaactc
tcttacggtattggcgacctggcctctaacatcctgctggatatcggtacgctttatctt
ttgaagttttataccgacgttctggggctgccaggcacctatggcggcattatctttttg
atttcaaaattctttactgcgtttaccgatatgggtaccggcattatgttggattcccga
cgcaagatcggtccaaaaggtaagttccgtccttttattctgtatgcgtcattcccggtc
accttactggcgatcgccaactttgtcggcacaccgtttgatgtcaccggtaaaacggtg
atggccactattctgtttatgctttacggactgtttttcagcatgatgaactgctcctac
ggcgcaatggttcccgctatcaccaaaaaccccaacgaacgcgcctcactggcggcatgg
cgtcagggcggcgctacgctgggcctgctgctgtgcacggtgggattcgtgccagttatg
aatcttatcgaaggtaatcagcaacttggctatatcttcgccgccacgctgttttcactg
tttggcctgctgtttatgtggatctgctactcgggcgtgaaagagcgttatgtcgaaacc
cagcctgctaatccggcgcaaaagccgggcctgctgcaatctttccgcgcaattgcgggt
aaccgcccgctgttcattctgtgcattgccaacctctgcactttaggggcgtttaacgtc
aagctcgccatccaggtctattacacccagtacgtgcttaacgatcccatcctgttgtcg
tatatgggatttttcagcatgggctgtattttcatcggcgtattcctgatgcctgcctca
gtcagacgttttggcaagaagaaagtttatatcggcggcctgctgatttgggtgctgggc
gatctgctcaactatttcttcggcggcggttcggtcagcttcgtggcgttctcctgcctg
gcgttctttggctcagcgtttgttaacagcctgaactgggcgctggtttccgacaccgtc
gagtacggcgagtggcgcaccggcgtgcgttcggaaggaacggtctacaccggttttacc
ttctttcgcaaagtgtctcaggcgctggctggtttcttccccggctggatgctgacgcaa
attggctatgtgccgaacgtcgcacaggctgaccacaccattgaagggttacgccagttg
atcttcatctacccaagcgcactggcggtagtcaccattgtggcgatgggttgcttctac
agcctgaacgagaagatgtatgtccgcattgtggaagagatagaagcccgtaaacgcacg
gcgtaa

DBGET integrated database retrieval system