KEGG   Escherichia coli K-12 MG1655: b3881Help
Entry
b3881             CDS       T00007                                 

Gene name
yihT
Definition
(RefSeq) 6-deoxy-6-sulphofructose-1-phosphate aldolase
  KO
K01671  sulfofructosephosphate aldolase [EC:4.1.2.57]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.57  sulfofructosephosphate aldolase
     b3881 (yihT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC Fibroin_P25
Motif
Other DBs
NCBI-GeneID: 948373
NCBI-ProteinID: NP_418317
Pasteur: yihT
RegulonDB: ECK120001777
ECOCYC: EG11846
ASAP: ABE-0012675
UniProt: P32141
Position
complement(4071773..4072651)
Genome map
AA seq 292 aa AA seqDB search
MNKYTINDITRASGGFAMLAVDQREAMRMMFAAAGAPAPVADSVLTDFKVNAAKALSPYA
SAILVDQQFCYRQVVEQNAIAKSCAMIVAADEFIPGNGIPVDSVVIDRKINPLQIKQDGG
KALKLLVLWRSDEDAQQRLDMVKEFNELCHSHGLVSIIEPVVRPPRRGDKFDREQAIIDA
AKELGDSGADLYKVEMPLYGKGPQQELLCASQRLNDHINMPWVILSSGVDEKLFPRAVRV
AMTAGASGFLAGRAVWASVVGLPDNELMLRDVCAPKLQQLGDIVDEMMAKRR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaataagtacaccatcaacgacattacgcgcgcatcgggcggttttgccatgctggcg
gtcgatcagcgcgaagccatgcgcatgatgtttgccgcggctggggcacccgctccggta
gccgatagcgttttaactgatttcaaagttaacgctgcaaaggccctctcgccttatgcc
tcggcgattctggtagatcaacaattctgctaccgccaggtggttgagcaaaacgcgatt
gccaaaagttgcgccatgattgtcgccgccgatgagttcattcctggcaacggtattccg
gtcgatagcgtggttattgaccgcaaaatcaatccgctacagatcaaacaagacggtggc
aaagccttaaaactgctggtgctgtggcgtagtgatgaagatgcgcagcaacgtctggat
atggtgaaagagttcaacgaactgtgccactcacacggtctggtaagcatcattgagcca
gtcgtccgcccaccgcgtcgtggcgataaattcgatcgcgaacaagcgatcatcgatgcc
gccaaagagctgggcgacagtggcgctgacctctacaaagttgaaatgccgctttatggc
aaaggtccgcaacaagagcttctctgtgcttcacaacgtctgaatgaccatatcaatatg
ccatgggtgatcctctcttccggtgtcgacgaaaaactgttcccgcgtgccgtacgcgtg
gcaatgacggcgggcgcatcgggattcctggcaggccgtgcagtctgggcatcggtcgtc
ggtttaccagacaacgagctgatgctgcgtgacgtttgcgcaccgaaattacaacaactt
ggcgatatcgtcgacgaaatgatggctaaacgccgctaa

DBGET integrated database retrieval system