KEGG   Escherichia coli K-12 MG1655: b3886Help
Entry
b3886             CDS       T00007                                 

Gene name
yihY
Definition
(RefSeq) BrkB family putative transporter, inner membrane protein
  KO
K07058  
membrane protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4076146..4077018
Genome map
AA seq 290 aa AA seqDB search
MLKTIQDKARHRTRPLWAWLKLLWQRIDEDNMTTLAGNLAYVSLLSLVPLVAVVFALFAA
FPMFSDVSIQLRHFIFANFLPATGDVIQRYIEQFVANSNKMTAVGACGLIVTALLLMYSI
DSALNTIWRSKRARPKIYSFAVYWMILTLGPLLAGASLAISSYLLSLRWASDLNTVIDNV
LRIFPLLLSWISFWLLYSIVPTIRVPNRDAIVGAFVAALLFEAGKKGFALYITMFPSYQL
IYGVLAVIPILFVWVYWTWCIVLLGAEITVTLGEYRKLKQAAEQEEDDEP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaaccattcaggacaaagccaggcaccgtacccgtccactatgggcctggcta
aaactactctggcaacgcattgatgaggacaacatgacaaccctggcaggtaaccttgcc
tatgtgtcgttgctctcattagtgccgctggttgccgttgtttttgcgcttttcgccgct
tttcccatgttttccgacgtcagcattcagttacgtcactttatttttgccaactttctg
cctgctactggcgatgttattcagcggtatatcgaacaatttgttgccaattccaacaag
atgaccgccgttggggcgtgcgggctgatcgtcaccgcgttattgttgatgtactccatc
gatagcgcgttgaataccatctggcgcagtaaacgagcgcgaccaaaaatttactcgttc
gccgtgtactggatgattttaacgctggggccgctgctggcaggggccagtctggcgatc
agttcctatttgctctccctgcgctgggcgagcgatctcaatactgtcatcgacaacgtg
ctgcgtatttttccgttgctgttgtcgtggatctccttctggttgctgtacagcattgtt
cctaccatccgcgtacctaaccgcgacgcgattgtcggcgcgtttgtcgccgcactcctg
ttcgaagcaggaaagaaaggtttcgcgctttatatcaccatgttcccgtcatatcagctc
atttatggtgtgctggcggtgatccccattctctttgtttgggtctactggacatggtgt
atcgtcttgcttggcgcggaaattactgtcactctcggggaataccgcaaactaaaacaa
gcagctgaacaagaagaagacgacgaaccatga

DBGET integrated database retrieval system