KEGG   Escherichia coli K-12 MG1655: b3894Help
Entry
b3894             CDS       T00007                                 

Gene name
fdoG
Definition
(RefSeq) formate dehydrogenase-O, large subunit (EC:1.2.1.2)
  KO
K00123  
formate dehydrogenase major subunit [EC:1.2.1.2]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    b3894 (fdoG)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    b3894 (fdoG)
  Energy metabolism
   00680 Methane metabolism
    b3894 (fdoG)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.2  formate dehydrogenase
     b3894 (fdoG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4082772..4085822)
Genome map
AA seq 1016 aa AA seqDB search
MQVSRRQFFKICAGGMAGTTAAALGFAPSVALAETRQYKLLRTRETRNTCTYCSVGCGLL
MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKFPEYRAPGSDK
WQQISWEEAFDRIAKLMKEDRDANYIAQNAEGVTVNRWLSTGMLCASASSNETGYLTQKF
SRALGMLAVDNQARVUHGPTVASLAPTFGRGAMTNHWVDIKNANLVVVMGGNAAEAHPVG
FRWAMEAKIHNGAKLIVIDPRFTRTAAVADYYAPIRSGTDIAFLSGVLLYLLNNEKFNRE
YTEAYTNASLIVREDYGFEDGLFTGYDAEKRKYDKSSWTYELDENGFAKRDTTLQHPRCV
WNLLKQHVSRYTPDVVENICGTPKDAFLKVCEYIAETSAHDKTASFLYALGWTQHSVGAQ
NIRTMAMIQLLLGNMGMAGGGVNALRGHSNIQGLTDLGLLSQSLPGYMTLPSEKQTDLQT
YLTANTPKPLLEGQVNYWGNYPKFFVSMMKAFFGDKATAENSWGFDWLPKWDKGYDVLQY
FEMMKEGKVNGYICQGFNPVASFPNKNKVIGCLSKLKFLVTIDPLNTETSNFWQNHGELN
EVDSSKIQTEVFRLPSTCFAEENGSIVNSGRWLQWHWKGADAPGIALTDGEILSGIFLRL
RKMYAEQGGANPDQVLNMTWNYAIPHEPSSEEVAMESNGKALADITDPATGAVIVKKGQQ
LSSFAQLRDDGTTSCGCWIFAGSWTPEGNQMARRDNADPSGLGNTLGWAWAWPLNRRILY
NRASADPQGNPWDPKRQLLKWDGTKWTGWDIPDYSAAPPGSGVGPFIMQQEGMGRLFALD
KMAEGPFPEHYEPFETPLGTNPLHPNVISNPAARIFKDDAEALGKADKFPYVGTTYRLTE
HFHYWTKHALLNAILQPEQFVEIGESLANKLGIAQGDTVKVSSNRGYIKAKAVVTKRIRT
LKANGKDIDTIGIPIHWGYEGVAKKGFIANTLTPFVGDANTQTPEFKSFLVNVEKV
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcagaaggcagttctttaagatctgcgctggcggtatggcaggcaccacg
gcagcggcactgggttttgcacccagcgtagcactcgcggaaacccggcagtataaactg
ctgcgcacccgcgaaacccgtaatacctgcacctattgttccgtaggctgtgggctgttg
atgtacagcctcggtgacggagcaaaaaacgccaaagcatctatcttccatatcgaaggc
gatccggatcacccggtcaaccgcggtgcactttgtccgaaaggcgctggcctggtggat
ttcatccactccgaaagccgtctgaagtttccggaataccgtgcgccaggttctgataaa
tggcagcaaatcagttgggaagaggcgtttgatcgcatcgccaaactgatgaaagaagac
cgcgatgctaactacattgcgcaaaacgccgaaggcgtgactgttaaccgctggctctcc
accgggatgctgtgtgcttccgcgtcgagtaacgaaaccggctatttaacgcaaaaattc
tcccgcgcgctgggtatgctcgcggtcgacaaccaggcgcgtgtctgacacggaccaacg
gtagcaagtcttgctccaacatttggtcgcggtgcgatgaccaaccactgggtcgacatc
aagaacgccaacctcgtcgtggtgatgggcggtaacgccgctgaagctcacccggtcggg
ttccgctgggcgatggaagccaaaattcacaacggcgcgaagctgattgtgatcgatcct
cgctttacgcgtacggcggcggtagctgactactatgcccctattcgttccggtactgac
attgctttcctgtcaggcgtattgctgtacctgctgaacaatgaaaaattcaaccgcgaa
tacaccgaagcctataccaacgccagcctgatcgtgcgtgaggattacggctttgaagat
ggcctgttcaccggctacgacgcggaaaaacgcaagtacgataaatcctcctggacttat
gaactggacgaaaacggcttcgccaaacgcgataccacgctgcaacatccgcgctgcgtg
tggaacttgctgaaacagcacgtttcccgctacacgccagatgtggttgaaaacatctgt
ggtacgccaaaagacgcgttcctgaaagtctgcgaatacatcgcagaaaccagtgctcac
gataaaactgcctcgttcctgtatgccctcggctggacgcaacactccgttggtgcgcaa
aacattcgtacgatggcgatgatccagctgctgctcggcaatatggggatggcaggcggc
ggcgttaacgccctgcgcggtcactccaatattcaggggctgacggacctggggctgctg
tcgcagagcctgccaggttacatgacgctgccaagcgagaagcagaccgatctgcaaacc
taccttaccgccaacacgccaaaaccgctgctggaaggccaggtaaactactggggcaac
tacccgaaattcttcgtctctatgatgaaggccttctttggtgataaagcgacggcggaa
aatagctggggctttgactggttgccgaagtgggataaaggctacgacgtcctgcaatac
ttcgagatgatgaaagagggcaaggtcaatggctatatctgccagggctttaaccctgtt
gcctcattcccgaacaaaaacaaagtgatcggttgtctgtcgaaactgaagttcctcgtc
accatcgacccactgaacactgaaacctctaacttctggcagaaccacggtgagctgaac
gaagttgactcgtcgaagatccagaccgaagtgttccgtctgccatcgacctgcttcgcg
gaagagaacggttctatcgttaactcaggtcgctggttacagtggcactggaaaggtgcg
gacgccccggggattgcgctgactgacggcgagatcctctccggtatcttcctgcgcttg
cgcaagatgtatgccgaacagggtggcgcgaacccggaccaggtgctgaacatgacatgg
aactacgccattccgcatgagccatcttcagaagaagtggcgatggagagcaacggtaag
gcgctggccgatattaccgatccggcaaccggtgcggttatcgtcaagaaaggccaacaa
cttagttcgttcgcccaattgcgcgatgacggtacaacctcctgtggctgctggattttc
gccggtagctggacgccggaaggcaaccagatggcacgccgtgataacgccgatccgtct
ggcctcggtaacacgctgggctgggcatgggcatggccgcttaaccgccgcattctgtat
aaccgcgcctccgcagatccgcagggtaacccgtgggatccgaagcgtcagttgctgaaa
tgggacggcactaagtggaccggctgggatattccggactacagcgcagcgcctccgggt
agcggcgtcgggccgtttatcatgcagcaggaaggcatggggcgtctgtttgccctcgat
aagatggcggaaggtccgttcccggaacactacgagccgtttgaaacgccgctgggaact
aacccgctgcatccaaacgttatctcgaacccggctgcacgtatctttaaagacgacgcc
gaagcattgggtaaagccgataagttcccgtatgtcggaaccacctatcgtctgaccgag
cacttccactactggaccaaacacgcgctgttgaacgcgattttgcagccagagcagttt
gtggaaatcggggagtcgctggcgaataaacttggcattgcccagggcgataccgtgaaa
gtctcctccaaccgtggctatatcaaagccaaagcggtggtgaccaaacgtattcgcacg
ctgaaagcgaacggcaaagatatcgataccatcggtattccgattcactggggctatgaa
ggcgtagctaaaaaaggctttattgccaatactttaacgccattcgttggtgatgcgaac
acgcagacgccggagtttaagtccttccttgtgaatgtggaaaaggtgtaa

DBGET integrated database retrieval system