KEGG   Escherichia coli K-12 MG1655: b3899Help
Entry
b3899             CDS       T00007                                 

Gene name
frvB
Definition
(RefSeq) putative PTS enzyme, IIB component/IIC component (EC:2.7.1.69)
  KO
K11202  
PTS system, fructose-specific IIB-like component [EC:2.7.1.-]
K11203  
PTS system, fructose-specific IIC-like component
Organism
eco  Escherichia coli K-12 MG1655
Module
PTS system, fructose-specific II-like component
Brite
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     b3899 (frvB)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II-like component [MD:M00306]
    b3899 (frvB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4090915..4092366)
Genome map
AA seq 483 aa AA seqDB search
MESSLRIVAITNCPAGIAHTYMVAEALEQKARSLGHTIKVETQGSSGVENRLSSEEIAAA
DYVILATGRGLSGDDRARFAGKKVYEIAISQALKNIDQIFSELPTNSQLFAADSGVKLGK
QEVQSGSVMSHLMAGVSAALPFVIGGGILVALANMLVQFGLPYTDMSKGAPSFTWVVESI
GYLGFTFMIPIMGAYIASSIADKPAFAPAFLVCYLANDKALLGTQSGAGFLGAVVLGLAI
GYFVFWFRKVRLGKALQPLLGSMLIPFVTLLVFGVLTYYVIGPVMSDLMGGLLHFLNTIP
PSMKFAAAFLVGAMLAFDMGGPINKTAWFFCFSLLEKHIYDWYAIVGVVALMPPVAAGLA
TFIAPKLFTRQEKEAASSAIVVGATVATEPAIPYALAAPLPMITANTLAGGITGVLVIAF
GIKRLAPGLGIFDPLIGLMSPVGSFYLVLAIGLALNISFIIVLKGLWLRRKAKAAQQELV
HEH
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggagtcatccttacgtattgtcgcgatcaccaactgccccgccgggatcgctcacacc
tacatggtggcggaagccctggaacagaaagcccgttctctcggtcataccataaaagtg
gaaactcaagggtccagtggcgttgaaaaccgcttatccagcgaagagattgccgctgcc
gattacgtcattctcgctaccgggcgtggcctgagcggtgatgatcgcgcgcggtttgcc
gggaagaaagtttatgagattgccatctcccaggcgttgaaaaatatcgaccagattttc
agcgaattaccgacaaactcgcagctttttgccgcagatagcggcgtgaagcttggcaaa
caggaagtgcaaagcggtagcgtgatgagccacctgatggcgggcgtctctgcggcgctg
ccgtttgtcatcggcggtggtatcctggtggcgcttgccaacatgctggtgcagttcggt
ttgccgtataccgatatgtcgaaaggcgcgccgtcgtttacctgggtagttgaatccatc
ggttaccttggcttcacctttatgatccccatcatgggcgcttatattgcctcgtcgatt
gccgataaaccggctttcgctccggcgtttctggtttgctatctggcgaacgacaaagcg
ctgctcggcacccagtcgggtgcgggattcctcggcgcggtggtgctggggctggcgatt
ggctatttcgtcttctggttccgcaaagtgcgccttggcaaagcattacaaccgctgctc
ggttcaatgctgatcccgttcgttactctgctggttttcggcgtgctcacttactacgtt
atcgggccggtgatgtccgacctcatgggcgggctgctccacttcctgaataccattcct
ccatcaatgaagtttgcggcagcgtttctggtcggtgcgatgctggcgttcgatatgggc
ggccccatcaataaaaccgcctggttcttctgcttctcactgctggaaaaacacatttat
gactggtacgccatcgtcggcgttgtcgcgctgatgccgcccgtcgcggcgggtcttgcg
acgttcattgcgcccaaactgtttacccgacaggaaaaagaggctgccagtagtgccatt
gtggtcggtgccacagtcgcaaccgaaccggctattccttacgctctggcagctccgttg
ccgatgattaccgccaatacgctggcgggcggcattaccggcgtgctggtgatcgctttc
ggaatcaaacgtctggcacctggtttgggtatctttgacccgctgatcggcctgatgtcg
ccggtgggttcgttttatctggtgctggcgattggcctcgcgctgaacatttcattcatt
atcgtcctgaaaggattgtggttacgccgcaaagcgaaagccgcgcaacaggagcttgtc
catgaacattga

DBGET integrated database retrieval system