KEGG   Escherichia coli K-12 MG1655: b3901Help
Entry
b3901             CDS       T00007                                 

Gene name
rhaM
Definition
(RefSeq) L-rhamnose mutarotase
  KO
K03534  
L-rhamnose mutarotase [EC:5.1.3.32]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.32  L-rhamnose mutarotase
     b3901 (rhaM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4093124..4093438)
Genome map
AA seq 104 aa AA seqDB search
MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIES
EERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcaaagcctttgtcatgcaggtaaaccccgacgcccacgaagagtatcagcgt
cggcataatcccatctggccagaactggaagcagtgctgaaatctcacggtgcgcataac
tacgccatctatctcgacaaagcgcgtaatctgctgtttgccatggtagagattgaatct
gaagaacgctggaatgcggttgccagcactgatgtttgccaacgttggtggaaatatatg
accgatgttatgcccgctaacccggataacagcccggtgagtagcgagctgcaagaagtg
ttttacctgccgtaa

DBGET integrated database retrieval system