KEGG   Escherichia coli K-12 MG1655: b3903Help
Entry
b3903             CDS       T00007                                 

Gene name
rhaA
Definition
(RefSeq) L-rhamnose isomerase (EC:5.3.1.14)
  KO
K01813  
L-rhamnose isomerase [EC:5.3.1.14]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    b3903 (rhaA)
Enzymes [BR:eco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.14  L-rhamnose isomerase
     b3903 (rhaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4094723..4095982)
Genome map
AA seq 419 aa AA seqDB search
MTTQLEQAWELAKQRFAAVGIDVEEALRQLDRLPVSMHCWQGDDVSGFENPEGSLTGGIQ
ATGNYPGKARNASELRADLEQAMRLIPGPKRLNLHAIYLESDTPVSRDQIKPEHFKNWVE
WAKANQLGLDFNPSCFSHPLSADGFTLSHADDSIRQFWIDHCKASRRVSAYFGEQLGTPS
VMNIWIPDGMKDITVDRLAPRQRLLAALDEVISEKLNPAHHIDAVESKLFGIGAESYTVG
SNEFYMGYATSRQTALCLDAGHFHPTEVISDKISAAMLYVPQLLLHVSRPVRWDSDHVVL
LDDETQAIASEIVRHDLFDRVHIGLDFFDASINRIAAWVIGTRNMKKALLRALLEPTAEL
RKLEAAGDYTARLALLEEQKSLPWQAVWEMYCQRHDTPAGSEWLESVRAYEKEILSRRG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccactcaactggaacaggcctgggagctagcgaaacagcgtttcgcggcggtgggg
attgatgtcgaggaggcgctgcgccaacttgatcgtttacccgtttcaatgcactgctgg
cagggcgatgatgtttccggttttgaaaacccggaaggttcgctgaccggggggattcag
gccacaggcaattatccgggcaaagcgcgtaatgccagtgagctacgtgccgatctggaa
caggctatgcggctgattccggggccgaaacggcttaatttacatgccatctatctggaa
tcagatacgccagtctcgcgcgaccagatcaaaccagagcacttcaaaaactgggttgaa
tgggcgaaagccaatcagctcggtctggattttaacccctcctgcttttcgcatccgcta
agcgccgatggctttacgctttcccatgccgacgacagcattcgccagttctggattgat
cactgcaaagccagccgtcgcgtttcggcctattttggcgagcaactcggcacaccatcg
gtgatgaacatctggatcccggatggtatgaaagatatcaccgttgaccgtctcgccccg
cgtcagcgtctgctggcagcactggatgaggtgatcagcgagaagctaaaccctgcgcac
catatcgacgccgttgagagcaaattgtttggcattggcgcagagagctacacggttggc
tccaatgagttttacatggggtatgccaccagccgccagactgcgctgtgcctggacgcc
gggcacttccacccgactgaagtgatttccgacaagatttccgccgccatgctgtatgtg
ccgcagttgctgctgcacgtcagccgtccggttcgctgggacagcgatcacgtagtgctg
ctggatgatgaaacccaggcaattgccagtgagattgtgcgtcacgatctgtttgaccgg
gtgcatatcggccttgacttcttcgatgcctctatcaaccgcattgccgcgtgggtcatt
ggtacacgcaatatgaaaaaagccctgctgcgtgcgttgctggaacctaccgctgagctg
cgcaagctggaagcggcgggcgattacactgcgcgtctggcactgctggaagagcagaaa
tcgttgccgtggcaggcggtctgggaaatgtattgccaacgtcacgatacgccagcaggt
agcgaatggctggagagcgtgcgggcttatgagaaagaaattttgagtcgccgcgggtaa

DBGET integrated database retrieval system