KEGG   Escherichia coli K-12 MG1655: b3909Help
Entry
b3909             CDS       T00007                                 

Gene name
kdgT
Definition
(RefSeq) 2-keto-3-deoxy-D-gluconate transporter
  KO
K02526  
2-keto-3-deoxygluconate permease
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3909 (kdgT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4101690..4102673
Genome map
AA seq 327 aa AA seqDB search
MQIKRSIEKIPGGMMLVPLFLGALCHTFSPGAGKYFGSFTNGMITGTVPILAVWFFCMGA
SIKLSATGTVLRKSGTLVVTKIAVAWVVAAIASRIIPEHGVEVGFFAGLSTLALVAAMDM
TNGGLYASIMQQYGTKEEAGAFVLMSLESGPLMTMIILGTAGIASFEPHVFVGAVLPFLV
GFALGNLDPELREFFSKAVQTLIPFFAFALGNTIDLTVIAQTGLLGILLGVAVIIVTGIP
LIIADKLIGGGDGTAGIAASSSAGAAVATPVLIAEMVPAFKPMAPAATSLVATAVIVTSI
LVPILTSIWSRKVKARAAKIEILGTVK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaacgctcgattgagaaaatcccgggggggatgatgctcgtcccgctattc
cttggcgcactgtgccacaccttctcgccgggggcggggaaatattttggatcattcacc
aacgggatgattaccggtacggtgcccattctggcggtgtggtttttttgcatgggggcg
tcaataaaattaagcgcgacgggaacggtactgcgtaaatccggtacgctggtggtaact
aaaattgccgtcgcgtgggtggttgcggcaattgcctcgcgtattattccggaacatggt
gttgaagttggattctttgccggactttcaacgctggcgctggtggcggcgatggatatg
accaatggcggactttacgcttccatcatgcagcagtacggcacaaaagaagaagctggg
gcatttgtgttgatgtcgttggagtccgggccgctcatgacgatgattattctgggcact
gccgggattgcctcgtttgaaccgcatgttttcgtcggcgcagtattaccgttcctggtg
ggctttgccctggggaaccttgaccctgaattgcgagaatttttcagcaaagcggtgcaa
acgctgattccattctttgccttcgcgctgggcaataccattgatttgactgtgattgcc
cagactggtttgctggggatcctgttgggtgtggcagtaattatcgtgaccggtattccg
ttgattatcgccgataaattgattggcggtggcgatggcactgccggaattgccgcttcc
agttccgcaggggccgcggtagcgacacctgtgctgattgcagaaatggtgcctgcgttt
aaaccgatggctccggcagcaacttcgctggtagcgacggcggtcattgtgacttcgatt
ctggtgccaattcttacctctatctggtcacgtaaagtcaaagccagagcagcgaaaatc
gaaattttaggtacggtgaaataa

DBGET integrated database retrieval system