KEGG   Escherichia coli K-12 MG1655: b3915Help
Entry
b3915             CDS       T00007                                 

Gene name
fieF
Definition
(RefSeq) ferrous iron and zinc transporter
  KO
K13283  
ferrous-iron efflux pump FieF
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b3915 (fieF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
4106469..4107371
Genome map
AA seq 300 aa AA seqDB search
MNQSYGRLVSRAAIAATAMASLLLLIKIFAWWYTGSVSILAALVDSLVDIGASLTNLLVV
RYSLQPADDNHSFGHGKAESLAALAQSMFISGSALFLFLTGIQHLISPTPMTDPGVGVIV
TIVALICTIILVSFQRWVVRRTQSQAVRADMLHYQSDVMMNGAILLALGLSWYGWHRADA
LFALGIGIYILYSALRMGYEAVQSLLDRALPDEERQEIIDIVTSWPGVSGAHDLRTRQSG
PTRFIQIHLEMEDSLPLVQAHMVADQVEQAILRRFPGSDVIIHQDPCSVVPREGKRSMLS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaatcttatggacggctggtcagtcgggcggcgattgctgcgacggcgatggct
tcgctgctattgctgattaaaatttttgcatggtggtataccgggtcggtgagtattctc
gccgcgctggtggattcgctggtggatatcggcgcgtcgttgacgaatttattggtggtg
cgatattccctgcaacctgccgacgataatcactcgtttggtcacggtaaagctgagtcc
ctcgcggcgctggcgcaaagtatgtttatctccggttcggcactattcctgtttttgacg
ggtattcaacatctgatatctccaacaccgatgacagatccaggcgtcggggttatcgtg
acaattgtggcgctaatttgtacgattatccttgtctcgtttcagcgttgggtggtgcgg
cggacgcaaagccaggcggtgcgggctgatatgctacattaccagtctgatgttatgatg
aacggcgcaattctgctggcgctggggttgtcctggtacggctggcatcgcgccgatgct
ctgtttgcattgggaatcggcatctatattttatatagcgcgttacgcatgggatatgag
gcggtacagtcattactggatcgcgcattgcctgatgaggaacggcaagaaattattgat
atcgtgacttcctggccgggtgttagcggcgctcacgatcttcgcacgcggcagtcaggg
ccgacccgctttattcagattcatttggaaatggaagactctctgcctttggttcaggca
catatggtggcggatcaggtagagcaggctattttacggcgttttccgggatcggatgta
attatccatcaggacccctgttccgtcgtacccagggagggtaaacggtctatgctttca
taa

DBGET integrated database retrieval system