KEGG   Escherichia coli K-12 MG1655: b3927Help
Entry
b3927             CDS       T00007                                 

Gene name
glpF
Definition
(RefSeq) glycerol facilitator
  KO
K02440  
glycerol uptake facilitator protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    b3927 (glpF)
Ion channels [BR:eco04040]
 Non-ion channels
  Aquaglyceroporins or glycerol-uptake facilitators
   b3927 (glpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4117245..4118090)
Genome map
AA seq 281 aa AA seqDB search
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaacatcaaccttgaaaggccagtgcattgctgaattcctcggtaccgggttg
ttgattttcttcggtgtgggttgcgttgcagcactaaaagtcgctggtgcgtcttttggt
cagtgggaaatcagtgtcatttggggactgggggtggcaatggccatctacctgaccgca
ggggtttccggcgcgcatcttaatcccgctgttaccattgcattgtggctgtttgcctgt
ttcgacaagcgcaaagttattccttttatcgtttcacaagttgccggcgctttctgtgct
gcggctttagtttacgggctttactacaatttatttttcgacttcgagcagactcatcac
attgttcgcggcagcgttgaaagtgttgatctggctggcactttctctacttaccctaat
cctcatatcaattttgtgcaggctttcgcagttgagatggtgattaccgctattctgatg
gggctgatcctggcgttaacggacgatggcaacggtgtaccacgcggccctttggctccc
ttgctgattggtctactgattgcggtcattggcgcatctatgggcccattgacaggtttt
gccatgaacccagcgcgtgacttcggtccgaaagtctttgcctggctggcgggctggggc
aatgtcgcctttaccggcggcagagacattccttacttcctggtgccgcttttcggccct
atcgttggcgcgattgtaggtgcatttgcctaccgcaaactgattggtcgccatttgcct
tgcgatatctgtgttgtggaagaaaaggaaaccacaactccttcagaacaaaaagcttcg
ctgtaa

DBGET integrated database retrieval system