KEGG   Escherichia coli K-12 MG1655: b3943Help
Entry
b3943             CDS       T00007                                 

Gene name
yijE
Definition
(RefSeq) EamA-like transporter family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
4136108..4137013
Genome map
AA seq 301 aa AA seqDB search
MSAAGKSNPLAISGLVVLTLIWSYSWIFMKQVTSYIGAFDFTALRCIFGALVLFIVLLLR
GRGMRPTPFKYTLAIALLQTCGMVGLAQWALVSGGAGKVAILSYTMPFWVVIFAALFLGE
RLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSAMLAILSGVSWGASAIVAKRLYARHPR
VDLLSLTSWQMLYAALVMSVVALLVPQREIDWQPTVFWALAYSAILATALAWSLWLFVLK
NLPASIASLSTLAVPVCGVLFSWWLLGENPGAVEGSGIVLIVLALALVSRKKKEAVSVKR
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgcaggaaagagcaacccactggcaatcagtggcctggttgtgctcacactt
atctggagttatagctggattttcatgaagcaagtcaccagttacatcggtgccttcgac
tttaccgccttacgctgcattttcggcgctctcgttttattcatcgtccttttattacgt
ggtcgcggaatgcgcccgacaccgtttaaatacaccttagccattgccctgttacaaacc
tgcgggatggttggtctggcgcagtgggcgttggtcagcggaggtgcggggaaggtggcg
atcctgagctataccatgccgttctgggtggtgattttcgccgcgttgtttctcggtgaa
cgcctgcgacgtgggcaatatttcgcgattctgattgccgctttcggcttatttttggtg
ttgcagccgtggcaactcgatttctcttcgatgaaaagtgccatgctggcaatcctctcc
ggcgtcagttggggggcgagcgcgattgttgctaaacgtctgtatgcccgtcatccgcgc
gtggatttattgtcgttaacatcctggcagatgctgtatgcggcgctggtgatgagtgtg
gtcgctttactggtgccgcaacgtgaaattgactggcagcccaccgtgttctgggcgctg
gcctacagtgcgattctggcgacggcactggcgtggagcttatggttgtttgtattgaaa
aacttgcctgccagtattgccagcttaagcacactggccgttcccgtttgcggcgtactc
ttttcctggtggctgctcggcgagaatccgggggccgttgaaggtagcggtattgtgctg
attgtgctggcactggcgctggtgagccgtaagaaaaaagaagccgtcagtgtaaaaagg
atctga

DBGET integrated database retrieval system