KEGG   Escherichia coli K-12 MG1655: b3946Help
Entry
b3946             CDS       T00007                                 

Gene name
fsaB
Definition
(RefSeq) fructose-6-phosphate aldolase 2 (EC:4.1.2.-)
  KO
K08314  
fructose-6-phosphate aldolase 2 [EC:4.1.2.-]
Organism
eco  Escherichia coli K-12 MG1655
Brite
Enzymes [BR:eco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.-  
     b3946 (fsaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(4139046..4139708)
Genome map
AA seq 220 aa AA seqDB search
MELYLDTANVAEVERLARIFPIAGVTTNPSIIAASKESIWEVLPRLQKAIGDEGILFAQT
MSRDAQGMVEEAKRLRDAIPGIVVKIPVTSEGLAAIKILKKEGITTLGTAVYSAAQGLLA
ALAGAKYVAPYVNRVDAQGGDGIRTVQELQTLLEMHAPESMVLAASFKTPRQALDCLLAG
CESITLPLDVAQQMLNTPAVESAIEKFEHDWNAAFGTTHL
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggaactgtatctggacaccgctaacgtcgcagaagtcgaacgtctggcacgcatattc
cccattgccggggtgacaactaacccgagcattatcgctgccagcaaggagtccatatgg
gaagtgctgccgcgtctgcaaaaagcgattggtgatgagggcattctgtttgctcagacc
atgagccgcgacgcgcaggggatggtggaagaagcgaagcgcctgcgcgacgctattccg
ggtattgtggtgaaaatcccggtgacttccgaaggtctggcagcaattaaaatactgaaa
aaagagggtattactacacttggcactgctgtatatagcgccgcacaagggttattagcc
gcactggcaggggcaaaatacgttgctccgtatgttaaccgcgtagatgcccagggcgga
gacggcattcgtacggttcaggagctgcaaacgctgttagaaatgcacgcgccagaaagc
atggtgctggcagccagctttaaaacgccgcgtcaggcgctggactgtttactggcagga
tgtgaatccatcaccctgcccttagatgtagcgcaacaaatgctcaacacccctgcggta
gagtcagctatagagaagttcgaacacgactggaatgccgcatttggcactactcatctc
taa

DBGET integrated database retrieval system