KEGG   Escherichia coli K-12 MG1655: b3949Help
Entry
b3949             CDS       T00007                                 

Gene name
frwC
Definition
(RefSeq) putative enzyme IIC component of PTS
  KO
K11203  PTS system, fructose-specific IIC-like component
Organism
eco  Escherichia coli K-12 MG1655
Module
eco_M00306  PTS system, fructose-specific II-like component
Brite
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II-like component [MD:M00306]
    b3949 (frwC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 948448
NCBI-ProteinID: NP_418384
Pasteur: frwC
RegulonDB: ECK120001836
ECOCYC: EG11908
ASAP: ABE-0012928
UniProt: P32672
Position
4142530..4143609
Genome map
AA seq 359 aa AA seqDB search
MNELVQILKNTRQHLMTGVSHMIPFVVSGGILLAVSVMLYGKGAVPDAVADPNLKKLFDI
GVAGLTLMVPFLAAYIGYSIAERSALAPCAIGAWVGNSFGAGFFGALIAGIIGGIVVHYL
KKIPVHKVLRSVMPIFIIPIVGTLITAGIMMWGLGEPVGALTNSLTQWLQGMQQGSIVML
AVIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTVVAIAAVGICIPPLGMGLATLIGRKN
FSAEERETGKAALVMGCVGVTEGAIPFAAADPLRVIPSIMVGSVCGAVTAALVGAQCYAG
WGGLIVLPVVEGKLGYIAAVAVGAVVTAVCVNVLKSLARKNGSSTDEKEDDLDLDFEIN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagttggtgcagatcctgaaaaatacccgtcagcatttaatgacgggcgtttca
cacatgattcccttcgtggtatcgggcggtattttgctggcggtttccgtcatgttgtat
ggcaaaggcgcagtgccggatgccgtagccgatccaaatctgaaaaaactgtttgatatc
ggcgttgcgggcttgacgctgatggtgcctttcctcgcagcgtacatcggttattccatt
gcagagcgttctgcgctggctccgtgcgctatcggtgcctgggttggtaacagctttggt
gcgggcttctttggtgcactgatcgccgggattatcggcggcatcgtggtgcattacctg
aagaaaattccggtgcataaagttctgcgctcggtgatgcctatcttcattattcctatc
gtcggcacactgattaccgcaggcatcatgatgtggggcttgggcgagcctgtaggggcg
ttgaccaacagcctgactcagtggcttcaggggatgcagcagggcagcattgttatgctg
gcggtgatcatgggtctgatgctggcgttcgatatgggcggtccggttaacaaagtggcc
tatgccttcatgctgatttgcgttgctcagggtgtttataccgtggtggccatcgctgcc
gtgggtatttgtatcccgccgctggggatggggctggcgacgctgattggtcgtaaaaat
ttctccgcagaagagcgcgaaaccggcaaagcggcactggtgatgggctgtgttggcgtt
actgaaggggcgattcctttcgccgctgccgatccgctgcgtgtcattccttccatcatg
gtcggttcagtttgtggtgcagtaactgcggcgctggtcggtgcgcagtgctatgcaggc
tggggtggtctgattgtgctgccggtggttgaaggcaagctgggttatatcgcagcagtg
gctgtcggagcagtggtgacggctgtttgtgtgaacgtgctgaaaagtctggcgcgtaaa
aatgggtcttcgactgatgaaaaagaagacgacctggatttggattttgaaattaattaa

DBGET integrated database retrieval system